Panthera uncia (snow leopard): 125914709 Help Entry 125914709         CDS       T08832                                  Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism puc  Panthera uncia (snow leopard) Pathway puc01521   EGFR tyrosine kinase inhibitor resistance puc01522   Endocrine resistance puc01524   Platinum drug resistance puc04064   NF-kappa B signaling pathway puc04066   HIF-1 signaling pathway puc04071   Sphingolipid signaling pathway puc04115   p53 signaling pathway puc04140   Autophagy - animal puc04141   Protein processing in endoplasmic reticulum puc04151   PI3K-Akt signaling pathway puc04210   Apoptosis puc04215   Apoptosis - multiple species puc04217   Necroptosis puc04261   Adrenergic signaling in cardiomyocytes puc04340   Hedgehog signaling pathway puc04510   Focal adhesion puc04621   NOD-like receptor signaling pathway puc04630   JAK-STAT signaling pathway puc04722   Neurotrophin signaling pathway puc04725   Cholinergic synapse puc04915   Estrogen signaling pathway puc04928   Parathyroid hormone synthesis, secretion and action puc04933   AGE-RAGE signaling pathway in diabetic complications puc05014   Amyotrophic lateral sclerosis puc05022   Pathways of neurodegeneration - multiple diseases puc05132   Salmonella infection puc05145   Toxoplasmosis puc05152   Tuberculosis puc05161   Hepatitis B puc05162   Measles puc05168   Herpes simplex virus 1 infection puc05169   Epstein-Barr virus infection puc05170   Human immunodeficiency virus 1 infection puc05200   Pathways in cancer puc05206   MicroRNAs in cancer puc05207   Chemical carcinogenesis - receptor activation puc05210   Colorectal cancer puc05215   Prostate cancer puc05222   Small cell lung cancer puc05226   Gastric cancer puc05417   Lipid and atherosclerosis puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125914709  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     125914709    04630 JAK-STAT signaling pathway     125914709    04064 NF-kappa B signaling pathway     125914709    04066 HIF-1 signaling pathway     125914709    04071 Sphingolipid signaling pathway     125914709    04151 PI3K-Akt signaling pathway     125914709  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125914709   09143 Cell growth and death    04210 Apoptosis     125914709    04215 Apoptosis - multiple species     125914709    04217 Necroptosis     125914709    04115 p53 signaling pathway     125914709   09144 Cellular community - eukaryotes    04510 Focal adhesion     125914709  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     125914709   09152 Endocrine system    04915 Estrogen signaling pathway     125914709    04928 Parathyroid hormone synthesis, secretion and action     125914709   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     125914709   09156 Nervous system    04725 Cholinergic synapse     125914709    04722 Neurotrophin signaling pathway     125914709  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125914709    05206 MicroRNAs in cancer     125914709    05207 Chemical carcinogenesis - receptor activation     125914709   09162 Cancer: specific types    05210 Colorectal cancer     125914709    05226 Gastric cancer     125914709    05215 Prostate cancer     125914709    05222 Small cell lung cancer     125914709   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     125914709    05161 Hepatitis B     125914709    05162 Measles     125914709    05168 Herpes simplex virus 1 infection     125914709    05169 Epstein-Barr virus infection     125914709   09171 Infectious disease: bacterial    05132 Salmonella infection     125914709    05152 Tuberculosis     125914709   09174 Infectious disease: parasitic    05145 Toxoplasmosis     125914709   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     125914709    05022 Pathways of neurodegeneration - multiple diseases     125914709   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125914709    05418 Fluid shear stress and atherosclerosis     125914709   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     125914709   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     125914709    01524 Platinum drug resistance     125914709    01522 Endocrine resistance     125914709  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:puc01009]     125914709 Protein phosphatases and associated proteins [BR:puc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      125914709 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  125914709 NCBI-ProteinID:  XP_049476215 LinkDB All DBs Position D3 Genome browser AA seq 235 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPA RTSPPPPPVAPAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF TARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRH LHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK NT seq 708 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtatgataaccgggagatagtcatgaagtacatccac tataagctgtcgcagaggggctacgagtgggatgccggggacgcgggcgccgcgcccccg ggggccgcccccgcgccgggcatcttctcctcccagcccgggcgcacccctgcgcccgcc aggacctccccgccgccgcccccggtcgcccccgccgccgccgccgccgccgcgggccct gcgctcagccccgtgccacctgtggtccacctgaccctgcgccaggccggcgatgacttc tcccgtcgctaccgccgcgacttcgcggagatgtccagccagctgcacctgacacccttt accgcaaggggacgctttgccacggtggtggaggagctcttcagggatggagtgaactgg gggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccga gagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctgaaccggcac ctgcacacctggatccaagacaacggaggctgggatgcctttgtggaactgtacggcccc agcatgcagcctctgtttgatttctcctggctgtccctgaaggccctgctcagtctggcc ctggtgggggcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system