Panthera uncia (snow leopard): 125919321 Help Entry 125919321         CDS       T08832                                  Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism puc  Panthera uncia (snow leopard) Pathway puc04010   MAPK signaling pathway puc04014   Ras signaling pathway puc04015   Rap1 signaling pathway puc04024   cAMP signaling pathway puc04062   Chemokine signaling pathway puc04510   Focal adhesion puc04520   Adherens junction puc04611   Platelet activation puc04670   Leukocyte transendothelial migration puc04720   Long-term potentiation puc04722   Neurotrophin signaling pathway puc04934   Cushing syndrome puc04972   Pancreatic secretion puc05211   Renal cell carcinoma puc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125919321    04014 Ras signaling pathway     125919321    04015 Rap1 signaling pathway     125919321    04024 cAMP signaling pathway     125919321  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     125919321    04520 Adherens junction     125919321  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     125919321    04670 Leukocyte transendothelial migration     125919321    04062 Chemokine signaling pathway     125919321   09154 Digestive system    04972 Pancreatic secretion     125919321   09156 Nervous system    04720 Long-term potentiation     125919321    04722 Neurotrophin signaling pathway     125919321  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     125919321   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125919321   09167 Endocrine and metabolic disease    04934 Cushing syndrome     125919321  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:puc04147]     125919321    04031 GTP-binding proteins [BR:puc04031]     125919321 Exosome [BR:puc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125919321   Exosomal proteins of other body fluids (saliva and urine)    125919321   Exosomal proteins of colorectal cancer cells    125919321 GTP-binding proteins [BR:puc04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     125919321 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  125919321 NCBI-ProteinID:  XP_049481893 LinkDB All DBs Position B4:91105332..91148892 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKTRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagttgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttaccgcaatgagggatttatacatgaaaaacggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcaaatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaat tgtgcattcttagaatcctccgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaagacccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system