Panthera uncia (snow leopard): 125926261 Help Entry 125926261         CDS       T08832                                  Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism puc  Panthera uncia (snow leopard) Pathway puc03082   ATP-dependent chromatin remodeling puc04015   Rap1 signaling pathway puc04145   Phagosome puc04210   Apoptosis puc04390   Hippo signaling pathway puc04510   Focal adhesion puc04517   IgSF CAM signaling puc04518   Integrin signaling puc04520   Adherens junction puc04530   Tight junction puc04611   Platelet activation puc04613   Neutrophil extracellular trap formation puc04670   Leukocyte transendothelial migration puc04714   Thermogenesis puc04810   Regulation of actin cytoskeleton puc04814   Motor proteins puc04820   Cytoskeleton in muscle cells puc04919   Thyroid hormone signaling pathway puc04921   Oxytocin signaling pathway puc04971   Gastric acid secretion puc05014   Amyotrophic lateral sclerosis puc05100   Bacterial invasion of epithelial cells puc05132   Salmonella infection puc05135   Yersinia infection puc05164   Influenza A puc05205   Proteoglycans in cancer puc05225   Hepatocellular carcinoma puc05410   Hypertrophic cardiomyopathy puc05412   Arrhythmogenic right ventricular cardiomyopathy puc05414   Dilated cardiomyopathy puc05416   Viral myocarditis puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     125926261  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     125926261    04390 Hippo signaling pathway     125926261   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     125926261    04518 Integrin signaling     125926261  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     125926261   09143 Cell growth and death    04210 Apoptosis     125926261   09144 Cellular community - eukaryotes    04510 Focal adhesion     125926261    04520 Adherens junction     125926261    04530 Tight junction     125926261   09142 Cell motility    04814 Motor proteins     125926261    04820 Cytoskeleton in muscle cells     125926261    04810 Regulation of actin cytoskeleton     125926261  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     125926261    04613 Neutrophil extracellular trap formation     125926261    04670 Leukocyte transendothelial migration     125926261   09152 Endocrine system    04921 Oxytocin signaling pathway     125926261    04919 Thyroid hormone signaling pathway     125926261   09154 Digestive system    04971 Gastric acid secretion     125926261   09159 Environmental adaptation    04714 Thermogenesis     125926261  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     125926261   09162 Cancer: specific types    05225 Hepatocellular carcinoma     125926261   09172 Infectious disease: viral    05164 Influenza A     125926261   09171 Infectious disease: bacterial    05132 Salmonella infection     125926261    05135 Yersinia infection     125926261    05100 Bacterial invasion of epithelial cells     125926261   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     125926261   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     125926261    05410 Hypertrophic cardiomyopathy     125926261    05412 Arrhythmogenic right ventricular cardiomyopathy     125926261    05414 Dilated cardiomyopathy     125926261    05416 Viral myocarditis     125926261  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:puc03021]     125926261    03019 Messenger RNA biogenesis [BR:puc03019]     125926261    03036 Chromosome and associated proteins [BR:puc03036]     125926261    03029 Mitochondrial biogenesis [BR:puc03029]     125926261   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:puc04812]     125926261    04147 Exosome [BR:puc04147]     125926261 Transcription machinery [BR:puc03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      125926261 Messenger RNA biogenesis [BR:puc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      125926261 Chromosome and associated proteins [BR:puc03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      125926261     NuA4 complex      125926261   Chromatin remodeling factors    BAF complex     125926261    PBAF complex     125926261    GBAF(ncBAF) complex     125926261    SWR1 complex     125926261 Mitochondrial biogenesis [BR:puc03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     125926261 Cytoskeleton proteins [BR:puc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      125926261 Exosome [BR:puc04147]  Exosomal proteins   Proteins found in most exosomes    125926261 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin DUF6581 Motif Other DBs NCBI-GeneID:  125926261 NCBI-ProteinID:  XP_049491464 LinkDB All DBs Position E1:1382450..1385245 Genome browser AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaggagatcgccgcgctggtcatcgacaatggctctggcatgtgcaaggcgggc tttgctggggacgacgccccccgagccgtgttcccgtccatcgtcgggcggccccgacac cagggcgttatggtgggcatgggccagaaggactcctacgtgggcgacgaggcccagagc aagcggggcatcctgaccctcaagtaccccatcgaacacggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggcccccgaggag cacccggtgctgctcactgaggcccccttgaaccccaaggccaaccgtgagaagatgact cagatcatgttcgagaccttcaacaccccagccatgtacgtggccatccaggccgtgctg tccctgtacgcttctggccgcaccactggtattgtcatggactctggggatggggtcacc cacactgtgcccatctacgaggggtacgccctgccccacgccatcctgcgtctggacctg gctggccgggacctgacggactacctcatgaagatcctcacggagcgcggctacagtttc accaccaccgccgagcgggaaattgtgcgtgacatcaaggagaagctctgctacgtggcc ctggattttgagcaggagatggccacggccgcgtcctcgtcctccctggagaagagctac gagctgcccgacgggcaggtgatcaccatcggcaacgagcggttccgctgccccgaggcg ctcttccagccttccttcctgggtatggagtcctgtggcatccacgagaccaccttcaac tccatcatgaagtgtgacgtcgacatccggaaggacctctacgctaacacggtgctgtct ggcgggaccaccatgtaccccggcatcgccgacaggatgcagaaggagatcacagctctg gcgcccagcacgatgaagatcaagatcatcgctccccctgagcgcaagtactccgtgtgg atcgggggctccatcctggcgtcgctgtccaccttccagcagatgtggatcagcaagcag gagtacgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system