Panthera uncia (snow leopard): 125928308 Help Entry 125928308         CDS       T08832                                  Name (RefSeq) actin, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism puc  Panthera uncia (snow leopard) Pathway puc03082   ATP-dependent chromatin remodeling puc04015   Rap1 signaling pathway puc04145   Phagosome puc04210   Apoptosis puc04390   Hippo signaling pathway puc04510   Focal adhesion puc04517   IgSF CAM signaling puc04518   Integrin signaling puc04520   Adherens junction puc04530   Tight junction puc04611   Platelet activation puc04613   Neutrophil extracellular trap formation puc04670   Leukocyte transendothelial migration puc04714   Thermogenesis puc04810   Regulation of actin cytoskeleton puc04814   Motor proteins puc04820   Cytoskeleton in muscle cells puc04919   Thyroid hormone signaling pathway puc04921   Oxytocin signaling pathway puc04971   Gastric acid secretion puc05014   Amyotrophic lateral sclerosis puc05100   Bacterial invasion of epithelial cells puc05132   Salmonella infection puc05135   Yersinia infection puc05164   Influenza A puc05205   Proteoglycans in cancer puc05225   Hepatocellular carcinoma puc05410   Hypertrophic cardiomyopathy puc05412   Arrhythmogenic right ventricular cardiomyopathy puc05414   Dilated cardiomyopathy puc05416   Viral myocarditis puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     125928308  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     125928308    04390 Hippo signaling pathway     125928308   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     125928308    04518 Integrin signaling     125928308  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     125928308   09143 Cell growth and death    04210 Apoptosis     125928308   09144 Cellular community - eukaryotes    04510 Focal adhesion     125928308    04520 Adherens junction     125928308    04530 Tight junction     125928308   09142 Cell motility    04814 Motor proteins     125928308    04820 Cytoskeleton in muscle cells     125928308    04810 Regulation of actin cytoskeleton     125928308  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     125928308    04613 Neutrophil extracellular trap formation     125928308    04670 Leukocyte transendothelial migration     125928308   09152 Endocrine system    04921 Oxytocin signaling pathway     125928308    04919 Thyroid hormone signaling pathway     125928308   09154 Digestive system    04971 Gastric acid secretion     125928308   09159 Environmental adaptation    04714 Thermogenesis     125928308  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     125928308   09162 Cancer: specific types    05225 Hepatocellular carcinoma     125928308   09172 Infectious disease: viral    05164 Influenza A     125928308   09171 Infectious disease: bacterial    05132 Salmonella infection     125928308    05135 Yersinia infection     125928308    05100 Bacterial invasion of epithelial cells     125928308   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     125928308   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     125928308    05410 Hypertrophic cardiomyopathy     125928308    05412 Arrhythmogenic right ventricular cardiomyopathy     125928308    05414 Dilated cardiomyopathy     125928308    05416 Viral myocarditis     125928308  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:puc03021]     125928308    03019 Messenger RNA biogenesis [BR:puc03019]     125928308    03036 Chromosome and associated proteins [BR:puc03036]     125928308    03029 Mitochondrial biogenesis [BR:puc03029]     125928308   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:puc04812]     125928308    04147 Exosome [BR:puc04147]     125928308 Transcription machinery [BR:puc03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      125928308 Messenger RNA biogenesis [BR:puc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      125928308 Chromosome and associated proteins [BR:puc03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      125928308     NuA4 complex      125928308   Chromatin remodeling factors    BAF complex     125928308    PBAF complex     125928308    GBAF(ncBAF) complex     125928308    SWR1 complex     125928308 Mitochondrial biogenesis [BR:puc03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     125928308 Cytoskeleton proteins [BR:puc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      125928308 Exosome [BR:puc04147]  Exosomal proteins   Proteins found in most exosomes    125928308 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin DUF6581 Motif Other DBs NCBI-GeneID:  125928308 NCBI-ProteinID:  XP_049494921 LinkDB All DBs Position E3:30203669..30207016 Genome browser AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgatgatattgctgcgctcgtggtcgacaacggctccggcatgtgcaaggccggc ttcgcgggcgacgatgccccacgggccgtcttcccttccatcgtggggcgcccccggcac cagggcgtgatggtgggtatgggccagaaggactcctacgtgggcgatgaggcccagagc aagaggggcatcctgaccctgaagtaccccatcgagcacggtattgtcaccaactgggac gacatggagaagatctggcatcacactttctacaacgagctgcgtgtggcccccgaggag cacccagtgctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgacc cagatcatgtttgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctg tccctgtacgcctctggccgcaccaccggcatcgtgatggactccggggacggggtcacc cacactgtgcccatctacgaggggtacgccctgccccacgccatcctgcgtctggacctg gctggccgggacctgacggactacctcatgaagatcctcacggagcgcggctacagcttc accaccaccgccgagcgggaaattgtgcgtgacatcaaggagaagctctgctacgtggcc ttggacttcgagcaggagatggccaccgccgcgtcctcttcctccctggagaagagctac gagctgcccgacgggcaggtgatcaccatcggcaacgagcggttccgctgccccgaggcg ctcttccagccttccttcctgggcatggaatcctgtggcatccacgaaactaccttcaac tccatcatgaagtgcgacgtcgacatccgcaaggacctctacgccaacacggtgctgtct ggggggaccaccatgtaccccggcatcgcggaccggatgcagaaggagatcactgccctg gcgcccagcacgatgaagatcaagatcatcgcaccccccgagcgcaagtactccgtgtgg atcggtggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtatgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system