Panthera uncia (snow leopard): 125935484 Help Entry 125935484         CDS       T08832                                  Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism puc  Panthera uncia (snow leopard) Pathway puc04060   Cytokine-cytokine receptor interaction puc04151   PI3K-Akt signaling pathway puc04630   JAK-STAT signaling pathway puc04640   Hematopoietic cell lineage puc04657   IL-17 signaling pathway puc04658   Th1 and Th2 cell differentiation puc04659   Th17 cell differentiation puc04660   T cell receptor signaling pathway puc04664   Fc epsilon RI signaling pathway puc04672   Intestinal immune network for IgA production puc05140   Leishmaniasis puc05200   Pathways in cancer puc05310   Asthma puc05320   Autoimmune thyroid disease puc05321   Inflammatory bowel disease puc05330   Allograft rejection Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125935484    04151 PI3K-Akt signaling pathway     125935484   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125935484  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     125935484    04660 T cell receptor signaling pathway     125935484    04658 Th1 and Th2 cell differentiation     125935484    04659 Th17 cell differentiation     125935484    04657 IL-17 signaling pathway     125935484    04664 Fc epsilon RI signaling pathway     125935484    04672 Intestinal immune network for IgA production     125935484  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125935484   09174 Infectious disease: parasitic    05140 Leishmaniasis     125935484   09163 Immune disease    05310 Asthma     125935484    05320 Autoimmune thyroid disease     125935484    05321 Inflammatory bowel disease     125935484    05330 Allograft rejection     125935484  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125935484    00536 Glycosaminoglycan binding proteins [BR:puc00536]     125935484 Cytokines and neuropeptides [BR:puc04052]  Cytokines   Interleukins    125935484 Glycosaminoglycan binding proteins [BR:puc00536]  Heparan sulfate / Heparin   Cytokines    125935484 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 HHH_9 Ribosomal_S19e AAR2 Motif Other DBs NCBI-GeneID:  125935484 NCBI-ProteinID:  XP_049505124 LinkDB All DBs Position A1 Genome browser AA seq 133 aa AA seqDB search MGLTSQLIPALVCLLAFTSTFVHGQNFNNTLKEIIKTLNILTARNDSCMELTVMDVLAAP KNTSDKEIFCRATTVLRQIYTHHNCSTKFLKGLDRNLSSMANRTCSVNEVKKSTLKDFLE RLKAIMQKKYSKQ NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgattccagctctggtctgcttactagcatttaccagcacc ttcgtccacggccagaacttcaataatacgttgaaagagatcatcaaaacgttgaacatc ctcacagcgagaaacgactcgtgcatggagctgactgtcatggacgtcttggcagcccca aagaacacaagtgacaaggaaatcttctgcagagccacaaccgtgctccggcagatctat acacaccacaactgctccaccaaattcctcaaaggactcgacaggaacctcagcagcatg gcaaacaggacctgttctgtgaatgaagtcaagaagagtacactgaaagacttcttggaa aggctaaaagcgatcatgcaaaagaaatactcaaagcaatga

DBGET integrated database retrieval system