Panthera uncia (snow leopard): 125938466 Help Entry 125938466         CDS       T08832                                  Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism puc  Panthera uncia (snow leopard) Pathway puc01523   Antifolate resistance puc04010   MAPK signaling pathway puc04060   Cytokine-cytokine receptor interaction puc04061   Viral protein interaction with cytokine and cytokine receptor puc04064   NF-kappa B signaling pathway puc04071   Sphingolipid signaling pathway puc04150   mTOR signaling pathway puc04210   Apoptosis puc04217   Necroptosis puc04350   TGF-beta signaling pathway puc04380   Osteoclast differentiation puc04612   Antigen processing and presentation puc04620   Toll-like receptor signaling pathway puc04621   NOD-like receptor signaling pathway puc04622   RIG-I-like receptor signaling pathway puc04625   C-type lectin receptor signaling pathway puc04640   Hematopoietic cell lineage puc04650   Natural killer cell mediated cytotoxicity puc04657   IL-17 signaling pathway puc04660   T cell receptor signaling pathway puc04664   Fc epsilon RI signaling pathway puc04668   TNF signaling pathway puc04920   Adipocytokine signaling pathway puc04930   Type II diabetes mellitus puc04931   Insulin resistance puc04932   Non-alcoholic fatty liver disease puc04933   AGE-RAGE signaling pathway in diabetic complications puc04936   Alcoholic liver disease puc04940   Type I diabetes mellitus puc05010   Alzheimer disease puc05014   Amyotrophic lateral sclerosis puc05020   Prion disease puc05022   Pathways of neurodegeneration - multiple diseases puc05132   Salmonella infection puc05133   Pertussis puc05134   Legionellosis puc05135   Yersinia infection puc05140   Leishmaniasis puc05142   Chagas disease puc05143   African trypanosomiasis puc05144   Malaria puc05145   Toxoplasmosis puc05146   Amoebiasis puc05152   Tuberculosis puc05160   Hepatitis C puc05161   Hepatitis B puc05163   Human cytomegalovirus infection puc05164   Influenza A puc05165   Human papillomavirus infection puc05166   Human T-cell leukemia virus 1 infection puc05168   Herpes simplex virus 1 infection puc05169   Epstein-Barr virus infection puc05170   Human immunodeficiency virus 1 infection puc05171   Coronavirus disease - COVID-19 puc05205   Proteoglycans in cancer puc05310   Asthma puc05321   Inflammatory bowel disease puc05322   Systemic lupus erythematosus puc05323   Rheumatoid arthritis puc05330   Allograft rejection puc05332   Graft-versus-host disease puc05410   Hypertrophic cardiomyopathy puc05414   Dilated cardiomyopathy puc05417   Lipid and atherosclerosis puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125938466    04350 TGF-beta signaling pathway     125938466    04064 NF-kappa B signaling pathway     125938466    04668 TNF signaling pathway     125938466    04071 Sphingolipid signaling pathway     125938466    04150 mTOR signaling pathway     125938466   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125938466    04061 Viral protein interaction with cytokine and cytokine receptor     125938466  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     125938466    04217 Necroptosis     125938466  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     125938466    04620 Toll-like receptor signaling pathway     125938466    04621 NOD-like receptor signaling pathway     125938466    04622 RIG-I-like receptor signaling pathway     125938466    04625 C-type lectin receptor signaling pathway     125938466    04650 Natural killer cell mediated cytotoxicity     125938466    04612 Antigen processing and presentation     125938466    04660 T cell receptor signaling pathway     125938466    04657 IL-17 signaling pathway     125938466    04664 Fc epsilon RI signaling pathway     125938466   09152 Endocrine system    04920 Adipocytokine signaling pathway     125938466   09158 Development and regeneration    04380 Osteoclast differentiation     125938466  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     125938466   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125938466    05170 Human immunodeficiency virus 1 infection     125938466    05161 Hepatitis B     125938466    05160 Hepatitis C     125938466    05171 Coronavirus disease - COVID-19     125938466    05164 Influenza A     125938466    05168 Herpes simplex virus 1 infection     125938466    05163 Human cytomegalovirus infection     125938466    05169 Epstein-Barr virus infection     125938466    05165 Human papillomavirus infection     125938466   09171 Infectious disease: bacterial    05132 Salmonella infection     125938466    05135 Yersinia infection     125938466    05133 Pertussis     125938466    05134 Legionellosis     125938466    05152 Tuberculosis     125938466   09174 Infectious disease: parasitic    05146 Amoebiasis     125938466    05144 Malaria     125938466    05145 Toxoplasmosis     125938466    05140 Leishmaniasis     125938466    05142 Chagas disease     125938466    05143 African trypanosomiasis     125938466   09163 Immune disease    05310 Asthma     125938466    05322 Systemic lupus erythematosus     125938466    05323 Rheumatoid arthritis     125938466    05321 Inflammatory bowel disease     125938466    05330 Allograft rejection     125938466    05332 Graft-versus-host disease     125938466   09164 Neurodegenerative disease    05010 Alzheimer disease     125938466    05014 Amyotrophic lateral sclerosis     125938466    05020 Prion disease     125938466    05022 Pathways of neurodegeneration - multiple diseases     125938466   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125938466    05418 Fluid shear stress and atherosclerosis     125938466    05410 Hypertrophic cardiomyopathy     125938466    05414 Dilated cardiomyopathy     125938466   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     125938466    04940 Type I diabetes mellitus     125938466    04936 Alcoholic liver disease     125938466    04932 Non-alcoholic fatty liver disease     125938466    04931 Insulin resistance     125938466    04933 AGE-RAGE signaling pathway in diabetic complications     125938466   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     125938466  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125938466    00536 Glycosaminoglycan binding proteins [BR:puc00536]     125938466 Cytokines and neuropeptides [BR:puc04052]  Cytokines   Tumor necrosis fators    125938466 Glycosaminoglycan binding proteins [BR:puc00536]  Heparan sulfate / Heparin   Cytokines    125938466 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  125938466 NCBI-ProteinID:  XP_049509607 LinkDB All DBs Position B2 Genome browser AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR EELPHGLQLINPLPQTLRSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELT DNQLKVPSDGLYLIYSQVLFTGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcactccccaagaag gcagggggcccccagggctccagaaggtgcttgtgcctcagcctcttctccttcctcctc gtcgcaggagccaccacactcttctgcctgctgcactttggagtgatcggcccccagagg gaagagctcccacatggcctgcaactaatcaaccctctgccccagacactcagatcatct tctcgaactccgagtgacaagccagtagcccatgtagtagcaaaccccgaagctgaaggg caactccagtggctgagccggcgtgccaatgccctcctggccaatggcgtggagctgaca gacaaccagctgaaggtgccctcagacgggctgtacctcatctactcccaggtcctcttc acgggccaaggatgtccttccacacatgtgctcctcacccacaccatcagccgctttgcc gtttcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggag accccagagggggctgaggccaagccctggtatgagcccatctacctgggaggggtcttc caactggagaagggtgatcgactcagcgctgagatcaatctgcctgactatcttgacttt gccgagtctgggcaagtctactttggaatcattgccctgtga

DBGET integrated database retrieval system