Pantoea vagans C9-1: Pvag_0087 Help Entry Pvag_0087         CDS       T01326                                  Symbol folA Name (GenBank) dihydrofolate reductase type I   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism pva  Pantoea vagans C9-1 Pathway pva00670   One carbon pool by folate pva00790   Folate biosynthesis pva01100   Metabolic pathways pva01240   Biosynthesis of cofactors pva04981   Folate transport and metabolism Module pva_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pva00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Pvag_0087 (folA)    00670 One carbon pool by folate     Pvag_0087 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     Pvag_0087 (folA) Enzymes [BR:pva01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      Pvag_0087 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  ADO08307 LinkDB All DBs Position 92229..92711 Genome browser AA seq 160 aa AA seqDB search MISLIAALAADRIIGMENAMPWDLPADLAWFKRNTLKKPVIMGRLTFESIGRPLPGRLNI VVSSKPGTTEGVTWVTSLDEALQAAGDAEEIMVIGGGRVYEQMLKRADRLYLTHIDAEVE GDTQFPDYEPDEWQSTFSEFHDADEQNSHSYCFEILDRRR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattagtcttatcgcggcattagcagcagatcgcattattgggatggagaacgccatg ccgtgggacctgcctgcagatctggcgtggttcaaacgcaatacgctgaagaaaccggtc attatgggccgactgacctttgaatccatcgggcgcccgttacctggccggctgaacatc gtggtcagcagtaagccaggcaccacggaaggcgtcacctgggttacgtcgctggatgag gcgttacaggcagccggtgatgcagaagagatcatggtgattgggggtggacgcgtctac gagcagatgctgaagcgtgccgatcgtctctatctgacgcacattgatgcggaagtggaa ggcgatacgcagttcccggattacgagccggatgagtggcagtccacgttcagcgaattc cacgacgctgatgagcagaactcccacagctactgctttgagatcctcgaccgtcgccgt taa

DBGET integrated database retrieval system