Panicum virgatum (switchgrass): 120706260 Help Entry 120706260         CDS       T07260                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pvir  Panicum virgatum (switchgrass) Pathway pvir03420   Nucleotide excision repair pvir04120   Ubiquitin mediated proteolysis pvir04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pvir00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120706260    04120 Ubiquitin mediated proteolysis     120706260   09124 Replication and repair    03420 Nucleotide excision repair     120706260  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pvir04121]     120706260    03400 DNA repair and recombination proteins [BR:pvir03400]     120706260 Enzymes [BR:pvir01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120706260 Ubiquitin system [BR:pvir04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120706260   Multi subunit type E3    SCF complex     Ring finger protein      120706260    Cul2 complex      120706260    Cul3 complex      120706260    Cul4 complex      120706260    Cul7 complex      120706260    Cul8 complex      120706260    Cul9 complex      120706260 DNA repair and recombination proteins [BR:pvir03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120706260     TCR (transcription coupled repair) factors      Cul4-CSA complex       120706260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  120706260 NCBI-ProteinID:  XP_039846789 LinkDB All DBs Position 5K:complement(10840735..10844143) Genome browser AA seq 124 aa AA seqDB search MSAMETDINAPPPPAPAGEGSSAAGPSSSSSRKPNKRFEIKKWNAVALWAWDIVVDNCAI CRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQ KYGH NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgtccgccatggagaccgacatcaacgcgccgccgccgcccgcccccgccggcgaggga tcctccgcggccggcccgtcctcatcctcctcccgcaagcccaacaagcgcttcgagatc aagaagtggaacgccgtcgcgctctgggcatgggatatcgtcgtcgataactgcgccatc tgccgcaaccacatcatggatctatgcatcgagtgccaggcgaaccaggccagcgccacc agcgaggagtgcactgtcgcttggggtgtctgtaatcacgcttttcacttccactgcatc agcaggtggcttaagactcgacaagtgtgcccattagacaacagtgagtgggagttccag aaatatggccactag

DBGET integrated database retrieval system