Prionailurus viverrinus (fishing cat): 125146922 Help Entry 125146922         CDS       T09889                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv00510   N-Glycan biosynthesis pviv00513   Various types of N-glycan biosynthesis pviv04141   Protein processing in endoplasmic reticulum Module pviv_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:pviv00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     125146922 (TMEM258)    00513 Various types of N-glycan biosynthesis     125146922 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125146922 (TMEM258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  125146922 NCBI-ProteinID:  XP_047679797 LinkDB All DBs Position D1:110582333..110585485 Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagcccagtgaacccagctgtcttcccccat ctgaccgtggtgctgttggccattggcatgttctttaccgcctggttcttcgtctatgag gtgacctccaccaagtacactcgggatatctacaaagagctcctcatctccttggtggcc tcacttttcatgggctttggagttctcttcctgctgctctgggtcggcatctacgtgtga

DBGET integrated database retrieval system