Prionailurus viverrinus (fishing cat): 125176511 Help Entry 125176511         CDS       T09889                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv01523   Antifolate resistance pviv04010   MAPK signaling pathway pviv04014   Ras signaling pathway pviv04024   cAMP signaling pathway pviv04062   Chemokine signaling pathway pviv04064   NF-kappa B signaling pathway pviv04066   HIF-1 signaling pathway pviv04071   Sphingolipid signaling pathway pviv04137   Mitophagy - animal pviv04151   PI3K-Akt signaling pathway pviv04210   Apoptosis pviv04211   Longevity regulating pathway pviv04218   Cellular senescence pviv04380   Osteoclast differentiation pviv04613   Neutrophil extracellular trap formation pviv04620   Toll-like receptor signaling pathway pviv04621   NOD-like receptor signaling pathway pviv04622   RIG-I-like receptor signaling pathway pviv04623   Cytosolic DNA-sensing pathway pviv04625   C-type lectin receptor signaling pathway pviv04657   IL-17 signaling pathway pviv04658   Th1 and Th2 cell differentiation pviv04659   Th17 cell differentiation pviv04660   T cell receptor signaling pathway pviv04662   B cell receptor signaling pathway pviv04668   TNF signaling pathway pviv04722   Neurotrophin signaling pathway pviv04917   Prolactin signaling pathway pviv04920   Adipocytokine signaling pathway pviv04926   Relaxin signaling pathway pviv04931   Insulin resistance pviv04932   Non-alcoholic fatty liver disease pviv04933   AGE-RAGE signaling pathway in diabetic complications pviv04936   Alcoholic liver disease pviv05010   Alzheimer disease pviv05022   Pathways of neurodegeneration - multiple diseases pviv05030   Cocaine addiction pviv05132   Salmonella infection pviv05133   Pertussis pviv05134   Legionellosis pviv05135   Yersinia infection pviv05140   Leishmaniasis pviv05142   Chagas disease pviv05145   Toxoplasmosis pviv05146   Amoebiasis pviv05152   Tuberculosis pviv05160   Hepatitis C pviv05161   Hepatitis B pviv05162   Measles pviv05163   Human cytomegalovirus infection pviv05164   Influenza A pviv05165   Human papillomavirus infection pviv05166   Human T-cell leukemia virus 1 infection pviv05167   Kaposi sarcoma-associated herpesvirus infection pviv05168   Herpes simplex virus 1 infection pviv05169   Epstein-Barr virus infection pviv05170   Human immunodeficiency virus 1 infection pviv05171   Coronavirus disease - COVID-19 pviv05200   Pathways in cancer pviv05202   Transcriptional misregulation in cancer pviv05203   Viral carcinogenesis pviv05207   Chemical carcinogenesis - receptor activation pviv05208   Chemical carcinogenesis - reactive oxygen species pviv05212   Pancreatic cancer pviv05215   Prostate cancer pviv05220   Chronic myeloid leukemia pviv05221   Acute myeloid leukemia pviv05222   Small cell lung cancer pviv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pviv05321   Inflammatory bowel disease pviv05415   Diabetic cardiomyopathy pviv05417   Lipid and atherosclerosis pviv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125176511 (RELA)    04014 Ras signaling pathway     125176511 (RELA)    04064 NF-kappa B signaling pathway     125176511 (RELA)    04668 TNF signaling pathway     125176511 (RELA)    04066 HIF-1 signaling pathway     125176511 (RELA)    04071 Sphingolipid signaling pathway     125176511 (RELA)    04024 cAMP signaling pathway     125176511 (RELA)    04151 PI3K-Akt signaling pathway     125176511 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     125176511 (RELA)   09143 Cell growth and death    04210 Apoptosis     125176511 (RELA)    04218 Cellular senescence     125176511 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125176511 (RELA)    04620 Toll-like receptor signaling pathway     125176511 (RELA)    04621 NOD-like receptor signaling pathway     125176511 (RELA)    04622 RIG-I-like receptor signaling pathway     125176511 (RELA)    04623 Cytosolic DNA-sensing pathway     125176511 (RELA)    04625 C-type lectin receptor signaling pathway     125176511 (RELA)    04660 T cell receptor signaling pathway     125176511 (RELA)    04658 Th1 and Th2 cell differentiation     125176511 (RELA)    04659 Th17 cell differentiation     125176511 (RELA)    04657 IL-17 signaling pathway     125176511 (RELA)    04662 B cell receptor signaling pathway     125176511 (RELA)    04062 Chemokine signaling pathway     125176511 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     125176511 (RELA)    04917 Prolactin signaling pathway     125176511 (RELA)    04926 Relaxin signaling pathway     125176511 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     125176511 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     125176511 (RELA)   09149 Aging    04211 Longevity regulating pathway     125176511 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125176511 (RELA)    05202 Transcriptional misregulation in cancer     125176511 (RELA)    05207 Chemical carcinogenesis - receptor activation     125176511 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     125176511 (RELA)    05203 Viral carcinogenesis     125176511 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125176511 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     125176511 (RELA)    05221 Acute myeloid leukemia     125176511 (RELA)    05220 Chronic myeloid leukemia     125176511 (RELA)    05215 Prostate cancer     125176511 (RELA)    05222 Small cell lung cancer     125176511 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125176511 (RELA)    05170 Human immunodeficiency virus 1 infection     125176511 (RELA)    05161 Hepatitis B     125176511 (RELA)    05160 Hepatitis C     125176511 (RELA)    05171 Coronavirus disease - COVID-19     125176511 (RELA)    05164 Influenza A     125176511 (RELA)    05162 Measles     125176511 (RELA)    05168 Herpes simplex virus 1 infection     125176511 (RELA)    05163 Human cytomegalovirus infection     125176511 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     125176511 (RELA)    05169 Epstein-Barr virus infection     125176511 (RELA)    05165 Human papillomavirus infection     125176511 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     125176511 (RELA)    05135 Yersinia infection     125176511 (RELA)    05133 Pertussis     125176511 (RELA)    05134 Legionellosis     125176511 (RELA)    05152 Tuberculosis     125176511 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     125176511 (RELA)    05145 Toxoplasmosis     125176511 (RELA)    05140 Leishmaniasis     125176511 (RELA)    05142 Chagas disease     125176511 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     125176511 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     125176511 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     125176511 (RELA)   09165 Substance dependence    05030 Cocaine addiction     125176511 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125176511 (RELA)    05418 Fluid shear stress and atherosclerosis     125176511 (RELA)    05415 Diabetic cardiomyopathy     125176511 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     125176511 (RELA)    04932 Non-alcoholic fatty liver disease     125176511 (RELA)    04931 Insulin resistance     125176511 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     125176511 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     125176511 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pviv03000]     125176511 (RELA) Transcription factors [BR:pviv03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     125176511 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  125176511 NCBI-ProteinID:  XP_047734029 LinkDB All DBs Position D1:107606658..107615252 Genome browser AA seq 555 aa AA seqDB search MDDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSAAVPKPAPQPYPFTPSLSTINF EEFSPMVFPSGQIPSQTPALAPAPAPILAPAPASVPAPAPVPAPAPAPAPAPAPILAPGL AQAVVPPAPKTTQAGEGTLTEALLHLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQ LLNQGVSVAPHPAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSS IADMDFSALLSQISS NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgactgagccggcccaggcctctggcccttat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggt cgctccgcgggcagtatccccggcgagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacaccgggccagggacagttcgcatctcattggtcaccaaggac cctcctcatcggcctcacccccatgagctggtgggaaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgtatccagaccaacaacaatccc ttccaagttcccatagaagaacagcgtggggactacgacctgaatgcggtgcggctctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgccacctgtcctctcg catcccatctttgacaaccgtgcccccaacaccgcggagctcaagatctgccgagtgaac cgaaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacattgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttct caagctgacgtacaccgacaagtggccattgtgttccggacacctccctatgccgacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaatttcagtacttgccagacacagatgatcgtcaccggattgaggag aaacgcaaaaggacatacgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccggcctccaccccggcgcattgctgtgccttcccgaagctcagctgcc gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc gaggagttctcccccatggtcttcccttccgggcagatcccaagccagacccctgccttg gcaccagcccctgccccaatcctggccccggcccctgcctctgtcccggcccctgcccct gtccccgcccctgccccggccccagccccggcccctgccccaatcttagccccaggcctt gctcaggctgtggtcccgcctgctcccaagaccacccaggctggggaagggacgctgacg gaggccctgctgcacctgcagtttgacgccgatgaagacctgggggccctgctcggcaac agcgccgacccagcagtgttcacagacctggcatccgtcgacaactctgagtttcagcag ctgctgaaccagggtgtatctgtggccccccacccagctgagcccatgctgatggaatac cctgaggcaataactcgcctggtgacgggatcccagaggccccctgacccagctcccgct cccctgggggcctctgggcttcccaacggcctcctctcaggggatgaagacttctcttcc attgccgacatggacttctcagctcttctgagtcagatcagctcctaa

DBGET integrated database retrieval system