Pteropus vampyrus (large flying fox): 105299213 Help Entry 105299213         CDS       T07815                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp01522   Endocrine resistance pvp04010   MAPK signaling pathway pvp04024   cAMP signaling pathway pvp04210   Apoptosis pvp04380   Osteoclast differentiation pvp04620   Toll-like receptor signaling pathway pvp04657   IL-17 signaling pathway pvp04658   Th1 and Th2 cell differentiation pvp04659   Th17 cell differentiation pvp04660   T cell receptor signaling pathway pvp04662   B cell receptor signaling pathway pvp04668   TNF signaling pathway pvp04713   Circadian entrainment pvp04725   Cholinergic synapse pvp04728   Dopaminergic synapse pvp04915   Estrogen signaling pathway pvp04917   Prolactin signaling pathway pvp04921   Oxytocin signaling pathway pvp04926   Relaxin signaling pathway pvp04928   Parathyroid hormone synthesis, secretion and action pvp04932   Non-alcoholic fatty liver disease pvp04935   Growth hormone synthesis, secretion and action pvp05031   Amphetamine addiction pvp05132   Salmonella infection pvp05133   Pertussis pvp05135   Yersinia infection pvp05140   Leishmaniasis pvp05142   Chagas disease pvp05161   Hepatitis B pvp05162   Measles pvp05166   Human T-cell leukemia virus 1 infection pvp05167   Kaposi sarcoma-associated herpesvirus infection pvp05170   Human immunodeficiency virus 1 infection pvp05171   Coronavirus disease - COVID-19 pvp05200   Pathways in cancer pvp05207   Chemical carcinogenesis - receptor activation pvp05208   Chemical carcinogenesis - reactive oxygen species pvp05210   Colorectal cancer pvp05224   Breast cancer pvp05231   Choline metabolism in cancer pvp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pvp05323   Rheumatoid arthritis pvp05417   Lipid and atherosclerosis pvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105299213 (FOS)    04668 TNF signaling pathway     105299213 (FOS)    04024 cAMP signaling pathway     105299213 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105299213 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105299213 (FOS)    04660 T cell receptor signaling pathway     105299213 (FOS)    04658 Th1 and Th2 cell differentiation     105299213 (FOS)    04659 Th17 cell differentiation     105299213 (FOS)    04657 IL-17 signaling pathway     105299213 (FOS)    04662 B cell receptor signaling pathway     105299213 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     105299213 (FOS)    04917 Prolactin signaling pathway     105299213 (FOS)    04921 Oxytocin signaling pathway     105299213 (FOS)    04926 Relaxin signaling pathway     105299213 (FOS)    04935 Growth hormone synthesis, secretion and action     105299213 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     105299213 (FOS)   09156 Nervous system    04725 Cholinergic synapse     105299213 (FOS)    04728 Dopaminergic synapse     105299213 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     105299213 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     105299213 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105299213 (FOS)    05207 Chemical carcinogenesis - receptor activation     105299213 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     105299213 (FOS)    05231 Choline metabolism in cancer     105299213 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105299213 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     105299213 (FOS)    05224 Breast cancer     105299213 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105299213 (FOS)    05170 Human immunodeficiency virus 1 infection     105299213 (FOS)    05161 Hepatitis B     105299213 (FOS)    05171 Coronavirus disease - COVID-19     105299213 (FOS)    05162 Measles     105299213 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     105299213 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     105299213 (FOS)    05135 Yersinia infection     105299213 (FOS)    05133 Pertussis     105299213 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105299213 (FOS)    05142 Chagas disease     105299213 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     105299213 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     105299213 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105299213 (FOS)    05418 Fluid shear stress and atherosclerosis     105299213 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105299213 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     105299213 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pvp03000]     105299213 (FOS)    04131 Membrane trafficking [BR:pvp04131]     105299213 (FOS) Transcription factors [BR:pvp03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     105299213 (FOS) Membrane trafficking [BR:pvp04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     105299213 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 HALZ Macoilin Motif Other DBs NCBI-GeneID:  105299213 NCBI-ProteinID:  XP_011369143 UniProt:  A0A6P3QRD6 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNGQDFCTDLASSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTVTGSRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSMASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPAKNISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCATYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctccggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccagccggggacagtctctcctactaccactcaccggccgactctttctctagcatg ggctctcctgtcaacggacaggacttctgcactgatctggcctcctccagtgccaacttc atcccaactgtgactgccatctcaaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccatcccagaccagagcccctcacccctatggagttcccacc ccctcagctggggcttactccagagctggagtcatgaagactgtgacaggaagcagagct cagagcattggcaggaggggcaaggtagaacagttgtccccagaagaggaagagaaaagg agaatccgtagagaaaggaataagatggctgcagccaaatgcaggaaccggagaagggag ctgactgacacactccaagcggagacagaccaattagaagatgagaagtctgctttgcag actgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacctaggcttcccagaagagatgtctatggcttcc cttgatctgagtgggggcctgcctgaggctgccacccctgagtctgaggaggccttcacc ctgcccctcctcaatgaccctgagcctaagccctcagtggagcctgccaagaacatcagc agcatggagctgaaggctgagccctttgatgacttcctgttcccagcatcatccaggccc agtggctctgagaccgcccgctctgtgccagacatggatctgtctggttccttctatgca gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg gagcccctgtgcaccccggtggtcacctgtactcccagctgcgctacttacacgtcttcc tttgtcttcacctaccccgaagctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccctcctctgactcactgagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system