Pteropus vampyrus (large flying fox): 105302532 Help Entry 105302532         CDS       T07815                                  Symbol IKBKG Name (RefSeq) NF-kappa-B essential modulator   KO K07210   inhibitor of nuclear factor kappa-B kinase subunit gamma Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp01523   Antifolate resistance pvp04010   MAPK signaling pathway pvp04014   Ras signaling pathway pvp04062   Chemokine signaling pathway pvp04064   NF-kappa B signaling pathway pvp04151   PI3K-Akt signaling pathway pvp04210   Apoptosis pvp04380   Osteoclast differentiation pvp04620   Toll-like receptor signaling pathway pvp04621   NOD-like receptor signaling pathway pvp04622   RIG-I-like receptor signaling pathway pvp04623   Cytosolic DNA-sensing pathway pvp04625   C-type lectin receptor signaling pathway pvp04657   IL-17 signaling pathway pvp04658   Th1 and Th2 cell differentiation pvp04659   Th17 cell differentiation pvp04660   T cell receptor signaling pathway pvp04662   B cell receptor signaling pathway pvp04668   TNF signaling pathway pvp04920   Adipocytokine signaling pathway pvp04936   Alcoholic liver disease pvp05010   Alzheimer disease pvp05132   Salmonella infection pvp05135   Yersinia infection pvp05142   Chagas disease pvp05145   Toxoplasmosis pvp05160   Hepatitis C pvp05161   Hepatitis B pvp05162   Measles pvp05163   Human cytomegalovirus infection pvp05164   Influenza A pvp05165   Human papillomavirus infection pvp05166   Human T-cell leukemia virus 1 infection pvp05167   Kaposi sarcoma-associated herpesvirus infection pvp05168   Herpes simplex virus 1 infection pvp05169   Epstein-Barr virus infection pvp05170   Human immunodeficiency virus 1 infection pvp05171   Coronavirus disease - COVID-19 pvp05200   Pathways in cancer pvp05203   Viral carcinogenesis pvp05208   Chemical carcinogenesis - reactive oxygen species pvp05212   Pancreatic cancer pvp05215   Prostate cancer pvp05220   Chronic myeloid leukemia pvp05221   Acute myeloid leukemia pvp05222   Small cell lung cancer pvp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pvp05340   Primary immunodeficiency pvp05417   Lipid and atherosclerosis pvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105302532 (IKBKG)    04014 Ras signaling pathway     105302532 (IKBKG)    04064 NF-kappa B signaling pathway     105302532 (IKBKG)    04668 TNF signaling pathway     105302532 (IKBKG)    04151 PI3K-Akt signaling pathway     105302532 (IKBKG)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105302532 (IKBKG)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105302532 (IKBKG)    04621 NOD-like receptor signaling pathway     105302532 (IKBKG)    04622 RIG-I-like receptor signaling pathway     105302532 (IKBKG)    04623 Cytosolic DNA-sensing pathway     105302532 (IKBKG)    04625 C-type lectin receptor signaling pathway     105302532 (IKBKG)    04660 T cell receptor signaling pathway     105302532 (IKBKG)    04658 Th1 and Th2 cell differentiation     105302532 (IKBKG)    04659 Th17 cell differentiation     105302532 (IKBKG)    04657 IL-17 signaling pathway     105302532 (IKBKG)    04662 B cell receptor signaling pathway     105302532 (IKBKG)    04062 Chemokine signaling pathway     105302532 (IKBKG)   09152 Endocrine system    04920 Adipocytokine signaling pathway     105302532 (IKBKG)   09158 Development and regeneration    04380 Osteoclast differentiation     105302532 (IKBKG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105302532 (IKBKG)    05208 Chemical carcinogenesis - reactive oxygen species     105302532 (IKBKG)    05203 Viral carcinogenesis     105302532 (IKBKG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105302532 (IKBKG)   09162 Cancer: specific types    05212 Pancreatic cancer     105302532 (IKBKG)    05221 Acute myeloid leukemia     105302532 (IKBKG)    05220 Chronic myeloid leukemia     105302532 (IKBKG)    05215 Prostate cancer     105302532 (IKBKG)    05222 Small cell lung cancer     105302532 (IKBKG)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105302532 (IKBKG)    05170 Human immunodeficiency virus 1 infection     105302532 (IKBKG)    05161 Hepatitis B     105302532 (IKBKG)    05160 Hepatitis C     105302532 (IKBKG)    05171 Coronavirus disease - COVID-19     105302532 (IKBKG)    05164 Influenza A     105302532 (IKBKG)    05162 Measles     105302532 (IKBKG)    05168 Herpes simplex virus 1 infection     105302532 (IKBKG)    05163 Human cytomegalovirus infection     105302532 (IKBKG)    05167 Kaposi sarcoma-associated herpesvirus infection     105302532 (IKBKG)    05169 Epstein-Barr virus infection     105302532 (IKBKG)    05165 Human papillomavirus infection     105302532 (IKBKG)   09171 Infectious disease: bacterial    05132 Salmonella infection     105302532 (IKBKG)    05135 Yersinia infection     105302532 (IKBKG)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105302532 (IKBKG)    05142 Chagas disease     105302532 (IKBKG)   09163 Immune disease    05340 Primary immunodeficiency     105302532 (IKBKG)   09164 Neurodegenerative disease    05010 Alzheimer disease     105302532 (IKBKG)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105302532 (IKBKG)    05418 Fluid shear stress and atherosclerosis     105302532 (IKBKG)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105302532 (IKBKG)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     105302532 (IKBKG)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:pvp01001]     105302532 (IKBKG) Protein kinases [BR:pvp01001]  Serine/threonine kinases: Other   IKK family [OT]    105302532 (IKBKG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CC2-LZ zf_C2H2_10 Nairovirus_NSm Zn_SUZ12 SAM_Exu LLC1 Motif Other DBs NCBI-GeneID:  105302532 NCBI-ProteinID:  XP_023376406 UniProt:  A0A6P6BMV7 LinkDB All DBs Position Unknown AA seq 281 aa AA seqDB search MQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQARQLESEREAL QQQHSVQVDQLRMQNQSMDAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHMKSSMGT QLEELKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQA REKLAEKKELLQEQLEQLQREYSRLKASCQESARIEDMRKRHVEVSQPPLAPAPAHHSSH LVLPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE NT seq 846 nt NT seq  +upstreamnt  +downstreamnt atgcagcagatggccgaggacaaggcctcggtgaaagcccaggtgacatcgttgctgggg gagctccaggagagccagagtcgcctggaagctgccaccaaggagcggcaggctttggag ggcagggcccgggcggccagcgagcaggcccggcagctggagagcgagcgcgaggccctg cagcagcagcacagcgtgcaggtggaccagctgcgcatgcagaaccaaagcatggacgca gccctgcgcatggagcgccaggccgcctcggaggagaagcggaagctggcccagctgcag gtggcctatcaccagctcttccaagagtatgacaaccacatgaagagcagcatgggaacg cagctggaagagctcaagcagcagctgcagcaggccgaggaggccctggtggccaaacag gaagtgatcgacaagctgaaggaagaggccgagcagcacaagattgtgatggagaccgtg ccggtgctgaaggcccaggcggatatctacaaggcagacttccaggccgagaggcaggcc cgggagaagctggccgagaagaaggagctcctgcaggaacagctggagcagctgcagcgg gagtatagcaggttgaaggccagctgtcaggagtcggccaggattgaagatatgaggaag cggcatgtagaggtctcccagccccccttggcccctgccccagctcaccactcctctcac ctggtcctgcccagccagaggagaagcccccccgaggagccgcctgacttctgttgcccc aagtgccagtatcaggctcctgatatggacaccctgcagatacacgtcatggagtgcatc gagtag

DBGET integrated database retrieval system