Pteropus vampyrus (large flying fox): 105309141 Help Entry 105309141         CDS       T07815                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04060   Cytokine-cytokine receptor interaction pvp04151   PI3K-Akt signaling pathway pvp04217   Necroptosis pvp04380   Osteoclast differentiation pvp04620   Toll-like receptor signaling pathway pvp04621   NOD-like receptor signaling pathway pvp04622   RIG-I-like receptor signaling pathway pvp04623   Cytosolic DNA-sensing pathway pvp04630   JAK-STAT signaling pathway pvp04650   Natural killer cell mediated cytotoxicity pvp04668   TNF signaling pathway pvp04936   Alcoholic liver disease pvp05135   Yersinia infection pvp05142   Chagas disease pvp05152   Tuberculosis pvp05160   Hepatitis C pvp05161   Hepatitis B pvp05162   Measles pvp05163   Human cytomegalovirus infection pvp05164   Influenza A pvp05165   Human papillomavirus infection pvp05167   Kaposi sarcoma-associated herpesvirus infection pvp05168   Herpes simplex virus 1 infection pvp05169   Epstein-Barr virus infection pvp05170   Human immunodeficiency virus 1 infection pvp05171   Coronavirus disease - COVID-19 pvp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105309141 (IFNB1)    04668 TNF signaling pathway     105309141 (IFNB1)    04151 PI3K-Akt signaling pathway     105309141 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105309141 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105309141 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105309141 (IFNB1)    04621 NOD-like receptor signaling pathway     105309141 (IFNB1)    04622 RIG-I-like receptor signaling pathway     105309141 (IFNB1)    04623 Cytosolic DNA-sensing pathway     105309141 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     105309141 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     105309141 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105309141 (IFNB1)    05161 Hepatitis B     105309141 (IFNB1)    05160 Hepatitis C     105309141 (IFNB1)    05171 Coronavirus disease - COVID-19     105309141 (IFNB1)    05164 Influenza A     105309141 (IFNB1)    05162 Measles     105309141 (IFNB1)    05168 Herpes simplex virus 1 infection     105309141 (IFNB1)    05163 Human cytomegalovirus infection     105309141 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     105309141 (IFNB1)    05169 Epstein-Barr virus infection     105309141 (IFNB1)    05165 Human papillomavirus infection     105309141 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     105309141 (IFNB1)    05152 Tuberculosis     105309141 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     105309141 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105309141 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105309141 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pvp04052]     105309141 (IFNB1) Cytokines and neuropeptides [BR:pvp04052]  Cytokines   Interferons    105309141 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  105309141 NCBI-ProteinID:  XP_011383538 UniProt:  A0A6P3RV21 LinkDB All DBs Position Unknown AA seq 185 aa AA seqDB search MTNRCILQFALLLCFSTTALSMSYNWLRFQQRSSNLACLKLLWQLNGTPQYCHKDRMDFK LPAEIKQPQQFQKEDTVLIIHEMLRQIFDIFQRNFSSTGWNETIIMNLYVTLSGQMDRLE TAMEEMEEENFTWESMTVLHLKNYYFRIMRYLETKLYSRCAWTVVKAEILRNFFFLNGLT EYLQN NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaggtgcatcctccaatttgctctcctgttgtgtttctccaccacagctctt tccatgagctacaactggcttcgattccaacaaagaagcagcaatttagcctgcctgaag ctcctgtggcagttaaatggaactcctcaatattgccacaaggacaggatggacttcaag ctccctgcggagattaaacaaccacaacagttccagaaggaggataccgtattgatcatc catgagatgctccggcagatctttgatattttccaaagaaatttctctagcactggctgg aatgaaaccatcattatgaatctctatgtgacactcagtgggcagatggaccgtctggag acagctatggaggaaatggaggaggaaaacttcacctgggaaagcatgacagtgctgcat ctaaagaattattactttaggatcatgaggtacctggagaccaagttgtacagcagatgt gcctggacagtagtcaaagcggaaattctcaggaactttttcttccttaatggacttaca gaatacctccaaaactga

DBGET integrated database retrieval system