Phaseolus vulgaris (common bean): 137832686 Help Entry 137832686         CDS       T03093                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu03420   Nucleotide excision repair pvu04120   Ubiquitin mediated proteolysis pvu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pvu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     137832686    04120 Ubiquitin mediated proteolysis     137832686   09124 Replication and repair    03420 Nucleotide excision repair     137832686  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pvu04121]     137832686    03400 DNA repair and recombination proteins [BR:pvu03400]     137832686 Enzymes [BR:pvu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      137832686 Ubiquitin system [BR:pvu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    137832686   Multi subunit type E3    SCF complex     Ring finger protein      137832686    Cul2 complex      137832686    Cul3 complex      137832686    Cul4 complex      137832686    Cul7 complex      137832686    Cul8 complex      137832686    Cul9 complex      137832686 DNA repair and recombination proteins [BR:pvu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       137832686     TCR (transcription coupled repair) factors      Cul4-CSA complex       137832686 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  137832686 NCBI-ProteinID:  XP_068497093 LinkDB All DBs Position 11:12023355..12025749 Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMIPAGEPSSSAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgactcttgattccgacgtgccaatgattccggccggcgagccatcgagcagcgcc ggcccgtcttccaagaagcccaagcgcttcgagatcaagaagtggaacgccgtcgcactc tgggcttgggacatcgttgtcgataactgtgccatctgccggaaccacatcatggatctc tgcatcgagtgccaagccaaccaggccagcgcaactagcgaagaatgcactgtggcgtgg ggagtttgtaatcatgcttttcacttccactgcattagtcgatggctcaagacccgtcaa gtttgtcctctagataacagtgagtgggagtttcagaaatacggccactag

DBGET integrated database retrieval system