Phaseolus vulgaris (common bean): 137835542 Help Entry 137835542         CDS       T03093                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu03420   Nucleotide excision repair pvu04120   Ubiquitin mediated proteolysis pvu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pvu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     137835542    04120 Ubiquitin mediated proteolysis     137835542   09124 Replication and repair    03420 Nucleotide excision repair     137835542  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pvu04121]     137835542    03400 DNA repair and recombination proteins [BR:pvu03400]     137835542 Enzymes [BR:pvu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      137835542 Ubiquitin system [BR:pvu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    137835542   Multi subunit type E3    SCF complex     Ring finger protein      137835542    Cul2 complex      137835542    Cul3 complex      137835542    Cul4 complex      137835542    Cul7 complex      137835542    Cul8 complex      137835542    Cul9 complex      137835542 DNA repair and recombination proteins [BR:pvu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       137835542     TCR (transcription coupled repair) factors      Cul4-CSA complex       137835542 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  137835542 NCBI-ProteinID:  XP_068500192 LinkDB All DBs Position 5:complement(34490585..34493765) Genome browser AA seq 118 aa AA seqDB search MATLDSDVTMVPAGEPSSSTGPSCSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcgactctggattccgacgtgacgatggttccggccggcgaaccctccagcagcacc ggtccttcttgttccagcaagaagcccaagcgattcgagatcaagaagtggaatgccgtt gctctatgggcttgggatatcgttgtggacaattgtgctatctgcaggaaccatatcatg gatctctgtattgagtgccaggccaaccaggctagcgccactagcgaggaatgcactgta gcttggggagtttgtaaccatgcttttcacttccattgcataagccgatggctgaagacc cgtcaagtatgtccgctagataatagcgagtgggagtttcagaaatatggtcactag

DBGET integrated database retrieval system