Pistacia vera (pistachio): 116120238 Help Entry 116120238         CDS       T07386                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pvy  Pistacia vera (pistachio) Pathway pvy03420   Nucleotide excision repair pvy04120   Ubiquitin mediated proteolysis pvy04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pvy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     116120238    04120 Ubiquitin mediated proteolysis     116120238   09124 Replication and repair    03420 Nucleotide excision repair     116120238  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pvy04121]     116120238    03400 DNA repair and recombination proteins [BR:pvy03400]     116120238 Enzymes [BR:pvy01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      116120238 Ubiquitin system [BR:pvy04121]  Ubiquitin ligases (E3)   UBL E3 ligases    116120238   Multi subunit type E3    SCF complex     Ring finger protein      116120238    Cul2 complex      116120238    Cul3 complex      116120238    Cul4 complex      116120238    Cul7 complex      116120238    Cul8 complex      116120238    Cul9 complex      116120238 DNA repair and recombination proteins [BR:pvy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       116120238     TCR (transcription coupled repair) factors      Cul4-CSA complex       116120238 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_16 Motif Other DBs NCBI-GeneID:  116120238 NCBI-ProteinID:  XP_031262040 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search MSIDATKVSAAATEPPAGSSNQVGCCGSSRKHKRLELKKWTPITLWAWDIVVDNCAICRN HIMDRCIECQANQQTVTSEECTIAWGLCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYG V NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgtcaattgacgctaccaaggtctctgccgccgccaccgagccaccggccggcagctcg aaccaagtggggtgctgtggctcaagtcgaaaacacaaacgtttagaactcaagaagtgg actcctattactttatgggcttgggacatagttgtggacaactgtgctatctgcagaaac catatcatggatcgctgcattgagtgtcaagcgaatcagcaaactgtcaccagcgaagag tgcacaattgcttggggtttgtgcaaccatgccttccactttcactgcattagccgatgg ctcaagactcgccaagtttgcccattagataacagtgagtgggagtttcagaagtatggt gtctag

DBGET integrated database retrieval system