Plutella xylostella (diamondback moth): 105397966 Help Entry 105397966         CDS       T03915                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pxy  Plutella xylostella (diamondback moth) Pathway pxy03420   Nucleotide excision repair pxy04120   Ubiquitin mediated proteolysis pxy04141   Protein processing in endoplasmic reticulum pxy04310   Wnt signaling pathway pxy04341   Hedgehog signaling pathway - fly pxy04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:pxy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105397966    04120 Ubiquitin mediated proteolysis     105397966   09124 Replication and repair    03420 Nucleotide excision repair     105397966  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105397966    04341 Hedgehog signaling pathway - fly     105397966    04350 TGF-beta signaling pathway     105397966  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pxy04121]     105397966    03400 DNA repair and recombination proteins [BR:pxy03400]     105397966 Enzymes [BR:pxy01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105397966 Ubiquitin system [BR:pxy04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105397966   Multi subunit type E3    SCF complex     Ring finger protein      105397966    Cul2 complex      105397966    Cul3 complex      105397966    Cul4 complex      105397966    Cul7 complex      105397966    Cul8 complex      105397966    Cul9 complex      105397966 DNA repair and recombination proteins [BR:pxy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105397966     TCR (transcription coupled repair) factors      Cul4-CSA complex       105397966 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 PHD_NSD zf-RING_16 Motif Other DBs NCBI-GeneID:  105397966 NCBI-ProteinID:  XP_011568300 UniProt:  A0A8S4CZ98 LinkDB All DBs Position 13:4841353..4842617 Genome browser AA seq 113 aa AA seqDB search MASAMDVDDEEVEMASSSSGKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcttctgcaatggacgtagatgatgaagaagtcgagatggcttcctccagcagtgga aagggtgataagaaaagatttgaagtaaaaaagtggaatgccgtagctctctgggcctgg gatattgttgtcgacaactgtgctatatgccgtaatcacataatggatctctgtattgag tgccaagctaaccaagcctctgccaccagtgaagaatgcacagtagcctggggtgtatgc aatcatgctttccacttccactgcatctctcgttggctgaaaactcggcaagtctgtcca ttagacaatagagagtgggaattccaaaagtatggacactaa

DBGET integrated database retrieval system