Paracoccus yeei: A6J80_13905 Help Entry A6J80_13905       CDS       T04781                                  Name (GenBank) methanol dehydrogenase   KO K14029   methanol dehydrogenase (cytochrome c) subunit 2 [EC:1.1.2.7] Organism pye  Paracoccus yeei Pathway pye00010   Glycolysis / Gluconeogenesis pye00620   Pyruvate metabolism pye00625   Chloroalkane and chloroalkene degradation pye00680   Methane metabolism pye01100   Metabolic pathways pye01110   Biosynthesis of secondary metabolites pye01120   Microbial metabolism in diverse environments pye01200   Carbon metabolism Brite KEGG Orthology (KO) [BR:pye00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     A6J80_13905    00620 Pyruvate metabolism     A6J80_13905   09102 Energy metabolism    00680 Methane metabolism     A6J80_13905   09111 Xenobiotics biodegradation and metabolism    00625 Chloroalkane and chloroalkene degradation     A6J80_13905 Enzymes [BR:pye01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.2  With a cytochrome as acceptor     1.1.2.7  methanol dehydrogenase (cytochrome c)      A6J80_13905 SSDB OrthologParalogGFIT Motif Pfam:  MDH PepSY_2 Motif Other DBs NCBI-ProteinID:  ARC37324 UniProt:  A0A1V0GTX9 LinkDB All DBs Position complement(2320199..2320510) Genome browser AA seq 103 aa AA seqDB search MKRILTLTIAALTLATPALAYDGTNCKAPGNCWEPKPGYPEKVEGSQYDPQHDPAELSKQ GESLAVMDARNEWRVWNMKKTGTFEYDVRKIDGYDETKAPPAN NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaaacgcatcctgaccctgacgatcgccgccctgacgctggccaccccggccctcgcc tatgacggcaccaactgcaaggcgcccggcaactgctgggaacccaagcccggctatccc gaaaaggtcgagggctcgcaatacgatccgcagcacgacccggccgaactgtccaagcag ggcgagtcgctggccgtgatggacgcgcgcaacgaatggcgcgtctggaacatgaaaaag accggcacgttcgaatacgacgtgcgcaagatcgacggctatgacgaaaccaaggctccg cctgccaactaa

DBGET integrated database retrieval system