Puma yagouaroundi (jaguarundi): 121015982 Help Entry 121015982         CDS       T07555                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu01522   Endocrine resistance pyu01524   Platinum drug resistance pyu04010   MAPK signaling pathway pyu04071   Sphingolipid signaling pathway pyu04110   Cell cycle pyu04115   p53 signaling pathway pyu04137   Mitophagy - animal pyu04151   PI3K-Akt signaling pathway pyu04210   Apoptosis pyu04211   Longevity regulating pathway pyu04216   Ferroptosis pyu04218   Cellular senescence pyu04310   Wnt signaling pathway pyu04722   Neurotrophin signaling pathway pyu04919   Thyroid hormone signaling pathway pyu05012   Parkinson disease pyu05014   Amyotrophic lateral sclerosis pyu05016   Huntington disease pyu05160   Hepatitis C pyu05161   Hepatitis B pyu05162   Measles pyu05163   Human cytomegalovirus infection pyu05165   Human papillomavirus infection pyu05166   Human T-cell leukemia virus 1 infection pyu05167   Kaposi sarcoma-associated herpesvirus infection pyu05168   Herpes simplex virus 1 infection pyu05169   Epstein-Barr virus infection pyu05200   Pathways in cancer pyu05202   Transcriptional misregulation in cancer pyu05203   Viral carcinogenesis pyu05205   Proteoglycans in cancer pyu05206   MicroRNAs in cancer pyu05210   Colorectal cancer pyu05212   Pancreatic cancer pyu05213   Endometrial cancer pyu05214   Glioma pyu05215   Prostate cancer pyu05216   Thyroid cancer pyu05217   Basal cell carcinoma pyu05218   Melanoma pyu05219   Bladder cancer pyu05220   Chronic myeloid leukemia pyu05222   Small cell lung cancer pyu05223   Non-small cell lung cancer pyu05224   Breast cancer pyu05225   Hepatocellular carcinoma pyu05226   Gastric cancer pyu05230   Central carbon metabolism in cancer pyu05417   Lipid and atherosclerosis pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121015982 (TP53)    04310 Wnt signaling pathway     121015982 (TP53)    04071 Sphingolipid signaling pathway     121015982 (TP53)    04151 PI3K-Akt signaling pathway     121015982 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     121015982 (TP53)   09143 Cell growth and death    04110 Cell cycle     121015982 (TP53)    04210 Apoptosis     121015982 (TP53)    04216 Ferroptosis     121015982 (TP53)    04115 p53 signaling pathway     121015982 (TP53)    04218 Cellular senescence     121015982 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     121015982 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     121015982 (TP53)   09149 Aging    04211 Longevity regulating pathway     121015982 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121015982 (TP53)    05202 Transcriptional misregulation in cancer     121015982 (TP53)    05206 MicroRNAs in cancer     121015982 (TP53)    05205 Proteoglycans in cancer     121015982 (TP53)    05203 Viral carcinogenesis     121015982 (TP53)    05230 Central carbon metabolism in cancer     121015982 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     121015982 (TP53)    05212 Pancreatic cancer     121015982 (TP53)    05225 Hepatocellular carcinoma     121015982 (TP53)    05226 Gastric cancer     121015982 (TP53)    05214 Glioma     121015982 (TP53)    05216 Thyroid cancer     121015982 (TP53)    05220 Chronic myeloid leukemia     121015982 (TP53)    05217 Basal cell carcinoma     121015982 (TP53)    05218 Melanoma     121015982 (TP53)    05219 Bladder cancer     121015982 (TP53)    05215 Prostate cancer     121015982 (TP53)    05213 Endometrial cancer     121015982 (TP53)    05224 Breast cancer     121015982 (TP53)    05222 Small cell lung cancer     121015982 (TP53)    05223 Non-small cell lung cancer     121015982 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121015982 (TP53)    05161 Hepatitis B     121015982 (TP53)    05160 Hepatitis C     121015982 (TP53)    05162 Measles     121015982 (TP53)    05168 Herpes simplex virus 1 infection     121015982 (TP53)    05163 Human cytomegalovirus infection     121015982 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     121015982 (TP53)    05169 Epstein-Barr virus infection     121015982 (TP53)    05165 Human papillomavirus infection     121015982 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     121015982 (TP53)    05014 Amyotrophic lateral sclerosis     121015982 (TP53)    05016 Huntington disease     121015982 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121015982 (TP53)    05418 Fluid shear stress and atherosclerosis     121015982 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     121015982 (TP53)    01522 Endocrine resistance     121015982 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pyu03000]     121015982 (TP53)    03036 Chromosome and associated proteins [BR:pyu03036]     121015982 (TP53)    03400 DNA repair and recombination proteins [BR:pyu03400]     121015982 (TP53) Transcription factors [BR:pyu03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     121015982 (TP53) Chromosome and associated proteins [BR:pyu03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      121015982 (TP53) DNA repair and recombination proteins [BR:pyu03400]  Eukaryotic type   Check point factors    Other check point factors     121015982 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD DEC-1_N CEP1-DNA_bind Motif Other DBs NCBI-GeneID:  121015982 NCBI-ProteinID:  XP_040309269 LinkDB All DBs Position Unknown AA seq 386 aa AA seqDB search MQEPPLELTIEPPLSQETFSELWNLLPENNVLSSELSSAMNELPLSEDVANWLDEAPDDA SGMSAVPAPAAPAPATPAPAISWPLSSFVPSQKTYPGAYGFHLGFLQSGTAKSVTCTYSP PLNKLFCQLAKTCPVQLWVRSPPPPGTCVRAMAIYKKSEFMTEVVRRCPHHERCPDSSDG LAPPQHLIRVEGNLHAKYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMN RRPIITIITLEDSNGKLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCPEPPPGSTKRA LPPSTSSTPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQSGKEPGGSRAHSS HLKAKKGQSTSRHKKPMLKREGLDSD NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt atgcaggagccgccgttggaactcaccatcgagccccctctgagccaggagacattttcg gaattgtggaacctacttcccgaaaacaatgttctgtcttccgagctgtcctcagcgatg aatgagctgccgctctcggaagatgtcgcaaactggctggatgaagcaccagatgatgct tccggaatgtcagcggttccggcaccagcagcccctgcgccagccacccctgcgccagcc atctcctggcccctgtcatcctttgtcccttcgcagaagacctacccaggcgcctatggt ttccatttagggttcctgcagtcggggacagccaagtcggttacttgcacgtactcccct cccctcaacaagctgttttgccagctggcgaagacctgccccgtgcagctgtgggtccga tcgccgcccccaccgggaacctgtgtccgcgccatggccatctataagaagtcagagttc atgacagaggtcgtgaggcgctgtccccaccacgagcgctgccctgacagcagcgacggt ctggcgcctccccagcatctcatccgagtggaaggaaacttgcatgccaagtacctggac gacagaaacactttccgacatagcgtcgtggtgccctacgagccgcccgaggtcggctcc gactgtaccaccatccactacaatttcatgtgtaacagttcctgcatggggggcatgaac cggaggcccatcatcaccatcatcaccctggaagactccaatgggaagctgctgggacgg aacagcttcgaggtacgagtttgtgcctgtcctgggagagaccggcgcaccgaggaggaa aatttccgcaagaagggggagccttgccctgagccgccccctgggagcaccaagcgagcg ctgccccccagcaccagctctactcccccacaaaagaagaagccactggatggagaatat ttcacccttcagatccgtgggcgtgaacgcttcgagatgttccgagagctgaatgaggcc ttggagctgaaggatgcccagagtggaaaggagccaggcggaagcagggctcactccagc cacctgaaggctaagaaggggcagtctacctcccgccataaaaagccaatgttgaagaga gaggggctcgactcagactga

DBGET integrated database retrieval system