Herpailurus yagouaroundi (jaguarundi): 121022312 Help Entry 121022312         CDS       T07555                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu01523   Antifolate resistance pyu04010   MAPK signaling pathway pyu04060   Cytokine-cytokine receptor interaction pyu04061   Viral protein interaction with cytokine and cytokine receptor pyu04064   NF-kappa B signaling pathway pyu04071   Sphingolipid signaling pathway pyu04150   mTOR signaling pathway pyu04210   Apoptosis pyu04217   Necroptosis pyu04350   TGF-beta signaling pathway pyu04380   Osteoclast differentiation pyu04612   Antigen processing and presentation pyu04620   Toll-like receptor signaling pathway pyu04621   NOD-like receptor signaling pathway pyu04622   RIG-I-like receptor signaling pathway pyu04625   C-type lectin receptor signaling pathway pyu04640   Hematopoietic cell lineage pyu04650   Natural killer cell mediated cytotoxicity pyu04657   IL-17 signaling pathway pyu04660   T cell receptor signaling pathway pyu04664   Fc epsilon RI signaling pathway pyu04668   TNF signaling pathway pyu04920   Adipocytokine signaling pathway pyu04930   Type II diabetes mellitus pyu04931   Insulin resistance pyu04932   Non-alcoholic fatty liver disease pyu04933   AGE-RAGE signaling pathway in diabetic complications pyu04936   Alcoholic liver disease pyu04940   Type I diabetes mellitus pyu05010   Alzheimer disease pyu05014   Amyotrophic lateral sclerosis pyu05020   Prion disease pyu05022   Pathways of neurodegeneration - multiple diseases pyu05132   Salmonella infection pyu05133   Pertussis pyu05134   Legionellosis pyu05135   Yersinia infection pyu05140   Leishmaniasis pyu05142   Chagas disease pyu05143   African trypanosomiasis pyu05144   Malaria pyu05145   Toxoplasmosis pyu05146   Amoebiasis pyu05152   Tuberculosis pyu05160   Hepatitis C pyu05161   Hepatitis B pyu05163   Human cytomegalovirus infection pyu05164   Influenza A pyu05165   Human papillomavirus infection pyu05166   Human T-cell leukemia virus 1 infection pyu05168   Herpes simplex virus 1 infection pyu05169   Epstein-Barr virus infection pyu05170   Human immunodeficiency virus 1 infection pyu05171   Coronavirus disease - COVID-19 pyu05205   Proteoglycans in cancer pyu05310   Asthma pyu05321   Inflammatory bowel disease pyu05322   Systemic lupus erythematosus pyu05323   Rheumatoid arthritis pyu05330   Allograft rejection pyu05332   Graft-versus-host disease pyu05410   Hypertrophic cardiomyopathy pyu05414   Dilated cardiomyopathy pyu05417   Lipid and atherosclerosis pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121022312 (TNF)    04350 TGF-beta signaling pathway     121022312 (TNF)    04064 NF-kappa B signaling pathway     121022312 (TNF)    04668 TNF signaling pathway     121022312 (TNF)    04071 Sphingolipid signaling pathway     121022312 (TNF)    04150 mTOR signaling pathway     121022312 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121022312 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     121022312 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     121022312 (TNF)    04217 Necroptosis     121022312 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     121022312 (TNF)    04620 Toll-like receptor signaling pathway     121022312 (TNF)    04621 NOD-like receptor signaling pathway     121022312 (TNF)    04622 RIG-I-like receptor signaling pathway     121022312 (TNF)    04625 C-type lectin receptor signaling pathway     121022312 (TNF)    04650 Natural killer cell mediated cytotoxicity     121022312 (TNF)    04612 Antigen processing and presentation     121022312 (TNF)    04660 T cell receptor signaling pathway     121022312 (TNF)    04657 IL-17 signaling pathway     121022312 (TNF)    04664 Fc epsilon RI signaling pathway     121022312 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     121022312 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     121022312 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     121022312 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121022312 (TNF)    05170 Human immunodeficiency virus 1 infection     121022312 (TNF)    05161 Hepatitis B     121022312 (TNF)    05160 Hepatitis C     121022312 (TNF)    05171 Coronavirus disease - COVID-19     121022312 (TNF)    05164 Influenza A     121022312 (TNF)    05168 Herpes simplex virus 1 infection     121022312 (TNF)    05163 Human cytomegalovirus infection     121022312 (TNF)    05169 Epstein-Barr virus infection     121022312 (TNF)    05165 Human papillomavirus infection     121022312 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     121022312 (TNF)    05135 Yersinia infection     121022312 (TNF)    05133 Pertussis     121022312 (TNF)    05134 Legionellosis     121022312 (TNF)    05152 Tuberculosis     121022312 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     121022312 (TNF)    05144 Malaria     121022312 (TNF)    05145 Toxoplasmosis     121022312 (TNF)    05140 Leishmaniasis     121022312 (TNF)    05142 Chagas disease     121022312 (TNF)    05143 African trypanosomiasis     121022312 (TNF)   09163 Immune disease    05310 Asthma     121022312 (TNF)    05322 Systemic lupus erythematosus     121022312 (TNF)    05323 Rheumatoid arthritis     121022312 (TNF)    05321 Inflammatory bowel disease     121022312 (TNF)    05330 Allograft rejection     121022312 (TNF)    05332 Graft-versus-host disease     121022312 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     121022312 (TNF)    05014 Amyotrophic lateral sclerosis     121022312 (TNF)    05020 Prion disease     121022312 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     121022312 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121022312 (TNF)    05418 Fluid shear stress and atherosclerosis     121022312 (TNF)    05410 Hypertrophic cardiomyopathy     121022312 (TNF)    05414 Dilated cardiomyopathy     121022312 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     121022312 (TNF)    04940 Type I diabetes mellitus     121022312 (TNF)    04936 Alcoholic liver disease     121022312 (TNF)    04932 Non-alcoholic fatty liver disease     121022312 (TNF)    04931 Insulin resistance     121022312 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     121022312 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     121022312 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121022312 (TNF)    00536 Glycosaminoglycan binding proteins [BR:pyu00536]     121022312 (TNF) Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Tumor necrosis fators    121022312 (TNF) Glycosaminoglycan binding proteins [BR:pyu00536]  Heparan sulfate / Heparin   Cytokines    121022312 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  121022312 NCBI-ProteinID:  XP_040319266 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR EELPHGLQLINPLPQTLRSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELT DNQLKVPSDGLYLIYSQVLFTGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPVYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcactccccaagaag gcagggggcccccagggctccagaaggtgcttgtgcctcagcctcttctccttcctcctc gtcgcaggagccaccacactcttctgcctgctgcactttggagtgatcggcccccagagg gaagagctcccacatggcctgcaactaatcaaccctctgccccagacactcagatcatct tctcgaactccgagtgacaagccagtagcccatgtagtagcaaaccccgaagctgaaggg caactccagtggctgagccggcgtgccaatgccctcctggccaatggcgtggagctgaca gacaaccagctgaaggtgccctcagacgggctgtacctcatctactcccaggtcctcttc acgggccaaggatgtccttccacacatgtgctcctcacccacaccatcagccgctttgcc gtttcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggag accccagagggggctgaggccaagccctggtatgagcccgtctacctgggaggggtcttc caactggagaagggtgatcgactcagcgctgagatcaatctgcctgactatcttgacttt gccgagtctgggcaagtctactttggaatcattgccctgtga

DBGET integrated database retrieval system