Puma yagouaroundi (jaguarundi): 121023959 Help Entry 121023959         CDS       T07555                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu01523   Antifolate resistance pyu04010   MAPK signaling pathway pyu04014   Ras signaling pathway pyu04024   cAMP signaling pathway pyu04062   Chemokine signaling pathway pyu04064   NF-kappa B signaling pathway pyu04066   HIF-1 signaling pathway pyu04071   Sphingolipid signaling pathway pyu04137   Mitophagy - animal pyu04151   PI3K-Akt signaling pathway pyu04210   Apoptosis pyu04211   Longevity regulating pathway pyu04218   Cellular senescence pyu04380   Osteoclast differentiation pyu04613   Neutrophil extracellular trap formation pyu04620   Toll-like receptor signaling pathway pyu04621   NOD-like receptor signaling pathway pyu04622   RIG-I-like receptor signaling pathway pyu04623   Cytosolic DNA-sensing pathway pyu04625   C-type lectin receptor signaling pathway pyu04657   IL-17 signaling pathway pyu04658   Th1 and Th2 cell differentiation pyu04659   Th17 cell differentiation pyu04660   T cell receptor signaling pathway pyu04662   B cell receptor signaling pathway pyu04668   TNF signaling pathway pyu04722   Neurotrophin signaling pathway pyu04917   Prolactin signaling pathway pyu04920   Adipocytokine signaling pathway pyu04926   Relaxin signaling pathway pyu04931   Insulin resistance pyu04932   Non-alcoholic fatty liver disease pyu04933   AGE-RAGE signaling pathway in diabetic complications pyu04936   Alcoholic liver disease pyu05010   Alzheimer disease pyu05022   Pathways of neurodegeneration - multiple diseases pyu05030   Cocaine addiction pyu05132   Salmonella infection pyu05133   Pertussis pyu05134   Legionellosis pyu05135   Yersinia infection pyu05140   Leishmaniasis pyu05142   Chagas disease pyu05145   Toxoplasmosis pyu05146   Amoebiasis pyu05152   Tuberculosis pyu05160   Hepatitis C pyu05161   Hepatitis B pyu05162   Measles pyu05163   Human cytomegalovirus infection pyu05164   Influenza A pyu05165   Human papillomavirus infection pyu05166   Human T-cell leukemia virus 1 infection pyu05167   Kaposi sarcoma-associated herpesvirus infection pyu05168   Herpes simplex virus 1 infection pyu05169   Epstein-Barr virus infection pyu05170   Human immunodeficiency virus 1 infection pyu05171   Coronavirus disease - COVID-19 pyu05200   Pathways in cancer pyu05202   Transcriptional misregulation in cancer pyu05203   Viral carcinogenesis pyu05207   Chemical carcinogenesis - receptor activation pyu05208   Chemical carcinogenesis - reactive oxygen species pyu05212   Pancreatic cancer pyu05215   Prostate cancer pyu05220   Chronic myeloid leukemia pyu05221   Acute myeloid leukemia pyu05222   Small cell lung cancer pyu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pyu05321   Inflammatory bowel disease pyu05415   Diabetic cardiomyopathy pyu05417   Lipid and atherosclerosis pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121023959 (RELA)    04014 Ras signaling pathway     121023959 (RELA)    04064 NF-kappa B signaling pathway     121023959 (RELA)    04668 TNF signaling pathway     121023959 (RELA)    04066 HIF-1 signaling pathway     121023959 (RELA)    04071 Sphingolipid signaling pathway     121023959 (RELA)    04024 cAMP signaling pathway     121023959 (RELA)    04151 PI3K-Akt signaling pathway     121023959 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     121023959 (RELA)   09143 Cell growth and death    04210 Apoptosis     121023959 (RELA)    04218 Cellular senescence     121023959 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121023959 (RELA)    04620 Toll-like receptor signaling pathway     121023959 (RELA)    04621 NOD-like receptor signaling pathway     121023959 (RELA)    04622 RIG-I-like receptor signaling pathway     121023959 (RELA)    04623 Cytosolic DNA-sensing pathway     121023959 (RELA)    04625 C-type lectin receptor signaling pathway     121023959 (RELA)    04660 T cell receptor signaling pathway     121023959 (RELA)    04658 Th1 and Th2 cell differentiation     121023959 (RELA)    04659 Th17 cell differentiation     121023959 (RELA)    04657 IL-17 signaling pathway     121023959 (RELA)    04662 B cell receptor signaling pathway     121023959 (RELA)    04062 Chemokine signaling pathway     121023959 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     121023959 (RELA)    04917 Prolactin signaling pathway     121023959 (RELA)    04926 Relaxin signaling pathway     121023959 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     121023959 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     121023959 (RELA)   09149 Aging    04211 Longevity regulating pathway     121023959 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121023959 (RELA)    05202 Transcriptional misregulation in cancer     121023959 (RELA)    05207 Chemical carcinogenesis - receptor activation     121023959 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     121023959 (RELA)    05203 Viral carcinogenesis     121023959 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121023959 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     121023959 (RELA)    05221 Acute myeloid leukemia     121023959 (RELA)    05220 Chronic myeloid leukemia     121023959 (RELA)    05215 Prostate cancer     121023959 (RELA)    05222 Small cell lung cancer     121023959 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121023959 (RELA)    05170 Human immunodeficiency virus 1 infection     121023959 (RELA)    05161 Hepatitis B     121023959 (RELA)    05160 Hepatitis C     121023959 (RELA)    05171 Coronavirus disease - COVID-19     121023959 (RELA)    05164 Influenza A     121023959 (RELA)    05162 Measles     121023959 (RELA)    05168 Herpes simplex virus 1 infection     121023959 (RELA)    05163 Human cytomegalovirus infection     121023959 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     121023959 (RELA)    05169 Epstein-Barr virus infection     121023959 (RELA)    05165 Human papillomavirus infection     121023959 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     121023959 (RELA)    05135 Yersinia infection     121023959 (RELA)    05133 Pertussis     121023959 (RELA)    05134 Legionellosis     121023959 (RELA)    05152 Tuberculosis     121023959 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     121023959 (RELA)    05145 Toxoplasmosis     121023959 (RELA)    05140 Leishmaniasis     121023959 (RELA)    05142 Chagas disease     121023959 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     121023959 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     121023959 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     121023959 (RELA)   09165 Substance dependence    05030 Cocaine addiction     121023959 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121023959 (RELA)    05418 Fluid shear stress and atherosclerosis     121023959 (RELA)    05415 Diabetic cardiomyopathy     121023959 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121023959 (RELA)    04932 Non-alcoholic fatty liver disease     121023959 (RELA)    04931 Insulin resistance     121023959 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     121023959 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     121023959 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pyu03000]     121023959 (RELA) Transcription factors [BR:pyu03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     121023959 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  121023959 NCBI-ProteinID:  XP_040322176 LinkDB All DBs Position Unknown AA seq 555 aa AA seqDB search MDDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSAAVPKPAPQPYPFTPSLSTINF EEFSPMVFPSGQIPSQTPALAPAPAPILAPAPASVPAPAPVPAPTPAPAPAPAPILAPGL AQAVVPPAPKTTQAGEGTLTEALLHLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQ LLNQGVSVAPHPAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSS IADMDFSALLSQISS NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgactgagccggcccaggcctctggcccttat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggt cgctccgcgggcagtatccccggcgagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacaccgggccagggacagttcgcatctcattggtcaccaaggac ccccctcatcggcctcacccccatgagctggtgggaaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgtatccagaccaacaacaatccc ttccaagttcccatagaagaacagcgtggggactatgacctgaatgcggtgcggctctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgccacctgtcctctcg catcccatctttgacaaccgtgcccccaacaccgcggagctcaagatctgccgagtgaac cgaaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacattgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttct caagctgacgtacaccgacaagtggccattgtgttccggacacctccctatgccgacccc agcctgcaggcccctgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaatttcagtacttgccagacacagatgatcgtcaccggattgaggag aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccggcctccaccccggcgcattgctgtgccttcccgaagctcagctgcc gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc gaggagttctcccccatggtcttcccttccgggcagatcccaagccagacccctgccttg gcaccagcccctgccccaatcctggccccagcccctgcctctgtcccggcccctgcccct gtccccgcccctaccccggccccagccccggcccctgccccaatcttagccccaggcctt gctcaggctgtggtcccgcctgctcccaagaccacccaggctggggaagggacgctgacg gaggccctgctgcacctgcagtttgacgctgatgaagacctgggggccctgcttggcaac agcgccgacccagcagtgttcacagacctggcatccgtcgacaactctgagtttcagcag ctgctgaaccagggtgtatctgtggccccccacccagctgagcccatgctgatggaatac cctgaggcaataactcgcctggtgacggggtcccagaggccccctgacccagctcccgct cccctgggggcctccgggcttcccaacggcctcctctcaggggatgaagacttctcttcc attgccgacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system