Herpailurus yagouaroundi (jaguarundi): 121028638 Help Entry 121028638         CDS       T07555                                  Symbol IL6 Name (RefSeq) interleukin-6 isoform X1   KO K05405   interleukin 6 Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu01521   EGFR tyrosine kinase inhibitor resistance pyu01523   Antifolate resistance pyu04060   Cytokine-cytokine receptor interaction pyu04061   Viral protein interaction with cytokine and cytokine receptor pyu04066   HIF-1 signaling pathway pyu04068   FoxO signaling pathway pyu04151   PI3K-Akt signaling pathway pyu04218   Cellular senescence pyu04620   Toll-like receptor signaling pathway pyu04621   NOD-like receptor signaling pathway pyu04623   Cytosolic DNA-sensing pathway pyu04625   C-type lectin receptor signaling pathway pyu04630   JAK-STAT signaling pathway pyu04640   Hematopoietic cell lineage pyu04657   IL-17 signaling pathway pyu04659   Th17 cell differentiation pyu04668   TNF signaling pathway pyu04672   Intestinal immune network for IgA production pyu04931   Insulin resistance pyu04932   Non-alcoholic fatty liver disease pyu04933   AGE-RAGE signaling pathway in diabetic complications pyu04936   Alcoholic liver disease pyu05010   Alzheimer disease pyu05020   Prion disease pyu05022   Pathways of neurodegeneration - multiple diseases pyu05132   Salmonella infection pyu05133   Pertussis pyu05134   Legionellosis pyu05135   Yersinia infection pyu05142   Chagas disease pyu05143   African trypanosomiasis pyu05144   Malaria pyu05146   Amoebiasis pyu05152   Tuberculosis pyu05161   Hepatitis B pyu05162   Measles pyu05163   Human cytomegalovirus infection pyu05164   Influenza A pyu05166   Human T-cell leukemia virus 1 infection pyu05167   Kaposi sarcoma-associated herpesvirus infection pyu05168   Herpes simplex virus 1 infection pyu05169   Epstein-Barr virus infection pyu05171   Coronavirus disease - COVID-19 pyu05200   Pathways in cancer pyu05202   Transcriptional misregulation in cancer pyu05321   Inflammatory bowel disease pyu05323   Rheumatoid arthritis pyu05332   Graft-versus-host disease pyu05410   Hypertrophic cardiomyopathy pyu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121028638 (IL6)    04668 TNF signaling pathway     121028638 (IL6)    04066 HIF-1 signaling pathway     121028638 (IL6)    04068 FoxO signaling pathway     121028638 (IL6)    04151 PI3K-Akt signaling pathway     121028638 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121028638 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     121028638 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     121028638 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     121028638 (IL6)    04620 Toll-like receptor signaling pathway     121028638 (IL6)    04621 NOD-like receptor signaling pathway     121028638 (IL6)    04623 Cytosolic DNA-sensing pathway     121028638 (IL6)    04625 C-type lectin receptor signaling pathway     121028638 (IL6)    04659 Th17 cell differentiation     121028638 (IL6)    04657 IL-17 signaling pathway     121028638 (IL6)    04672 Intestinal immune network for IgA production     121028638 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121028638 (IL6)    05202 Transcriptional misregulation in cancer     121028638 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121028638 (IL6)    05161 Hepatitis B     121028638 (IL6)    05171 Coronavirus disease - COVID-19     121028638 (IL6)    05164 Influenza A     121028638 (IL6)    05162 Measles     121028638 (IL6)    05168 Herpes simplex virus 1 infection     121028638 (IL6)    05163 Human cytomegalovirus infection     121028638 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     121028638 (IL6)    05169 Epstein-Barr virus infection     121028638 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     121028638 (IL6)    05135 Yersinia infection     121028638 (IL6)    05133 Pertussis     121028638 (IL6)    05134 Legionellosis     121028638 (IL6)    05152 Tuberculosis     121028638 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     121028638 (IL6)    05144 Malaria     121028638 (IL6)    05142 Chagas disease     121028638 (IL6)    05143 African trypanosomiasis     121028638 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     121028638 (IL6)    05321 Inflammatory bowel disease     121028638 (IL6)    05332 Graft-versus-host disease     121028638 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     121028638 (IL6)    05020 Prion disease     121028638 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     121028638 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121028638 (IL6)    05410 Hypertrophic cardiomyopathy     121028638 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121028638 (IL6)    04932 Non-alcoholic fatty liver disease     121028638 (IL6)    04931 Insulin resistance     121028638 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     121028638 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     121028638 (IL6)    01523 Antifolate resistance     121028638 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121028638 (IL6) Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Interleukins    121028638 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 GCSF IL23 Sec16 DUF4924 Motif Other DBs NCBI-GeneID:  121028638 NCBI-ProteinID:  XP_040328390 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSEAHSALEPTRNERELHLPSGTPAMTFLSTSAFSPLAFSLGLLLVVATAFPTPGPLGGD ATSNRLPLTSADKMEELIKYILGKISALKKEMCDNYNKCEDSKEALAENNLNLPKLAEKD GCFQSGFNQETCLTRITTGLQEFQIYLKFLQDKYEGDKENAKSVYTSTNVLLQMLKRKGK NQDEVTIPVPTVEVGLQAKLQSQEEWLRHTTIHLTLRRLEDFLQFSLRAVRIM NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctgaggctcattctgccctcgagcccaccaggaacgaaagagagctccatctgccc tccgggactccagctatgaccttcctctccacaagcgccttcagtccactcgccttctcc ctggggctgctcctggtggtggctactgctttccctaccccgggacccctgggaggagat gccacctcaaatagactaccactcacctctgcagacaaaatggaagaactcattaagtac atcctcggcaaaatctctgcactgaaaaaggagatgtgtgacaactataacaaatgtgag gacagcaaggaggcactggcagaaaacaacctaaatcttccgaaactggcagaaaaagat ggatgcttccaatctgggttcaatcaggagacctgcctgacaagaatcactactggtctt caggagtttcagatatacctgaaattcctccaggacaagtatgagggtgataaggaaaat gccaagtctgtgtacaccagtactaacgtcctgctccagatgctgaagcgtaagggaaag aatcaggatgaggtaaccatccctgtcccaaccgtagaagttggcctgcaggctaagctg cagtcacaggaagagtggctgaggcacacaacaattcatctcaccctgcgaaggctggag gacttccttcagttcagcctcagggctgttcggataatgtaa

DBGET integrated database retrieval system