Herpailurus yagouaroundi (jaguarundi): 121032071 Help Entry 121032071         CDS       T07555                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu01522   Endocrine resistance pyu04010   MAPK signaling pathway pyu04024   cAMP signaling pathway pyu04210   Apoptosis pyu04380   Osteoclast differentiation pyu04620   Toll-like receptor signaling pathway pyu04657   IL-17 signaling pathway pyu04658   Th1 and Th2 cell differentiation pyu04659   Th17 cell differentiation pyu04660   T cell receptor signaling pathway pyu04662   B cell receptor signaling pathway pyu04668   TNF signaling pathway pyu04713   Circadian entrainment pyu04725   Cholinergic synapse pyu04728   Dopaminergic synapse pyu04915   Estrogen signaling pathway pyu04917   Prolactin signaling pathway pyu04921   Oxytocin signaling pathway pyu04926   Relaxin signaling pathway pyu04928   Parathyroid hormone synthesis, secretion and action pyu04932   Non-alcoholic fatty liver disease pyu04935   Growth hormone synthesis, secretion and action pyu05031   Amphetamine addiction pyu05132   Salmonella infection pyu05133   Pertussis pyu05135   Yersinia infection pyu05140   Leishmaniasis pyu05142   Chagas disease pyu05161   Hepatitis B pyu05162   Measles pyu05166   Human T-cell leukemia virus 1 infection pyu05167   Kaposi sarcoma-associated herpesvirus infection pyu05170   Human immunodeficiency virus 1 infection pyu05171   Coronavirus disease - COVID-19 pyu05200   Pathways in cancer pyu05207   Chemical carcinogenesis - receptor activation pyu05208   Chemical carcinogenesis - reactive oxygen species pyu05210   Colorectal cancer pyu05224   Breast cancer pyu05231   Choline metabolism in cancer pyu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pyu05323   Rheumatoid arthritis pyu05417   Lipid and atherosclerosis pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121032071 (FOS)    04668 TNF signaling pathway     121032071 (FOS)    04024 cAMP signaling pathway     121032071 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     121032071 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121032071 (FOS)    04660 T cell receptor signaling pathway     121032071 (FOS)    04658 Th1 and Th2 cell differentiation     121032071 (FOS)    04659 Th17 cell differentiation     121032071 (FOS)    04657 IL-17 signaling pathway     121032071 (FOS)    04662 B cell receptor signaling pathway     121032071 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     121032071 (FOS)    04917 Prolactin signaling pathway     121032071 (FOS)    04921 Oxytocin signaling pathway     121032071 (FOS)    04926 Relaxin signaling pathway     121032071 (FOS)    04935 Growth hormone synthesis, secretion and action     121032071 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     121032071 (FOS)   09156 Nervous system    04725 Cholinergic synapse     121032071 (FOS)    04728 Dopaminergic synapse     121032071 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     121032071 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     121032071 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121032071 (FOS)    05207 Chemical carcinogenesis - receptor activation     121032071 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     121032071 (FOS)    05231 Choline metabolism in cancer     121032071 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121032071 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     121032071 (FOS)    05224 Breast cancer     121032071 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121032071 (FOS)    05170 Human immunodeficiency virus 1 infection     121032071 (FOS)    05161 Hepatitis B     121032071 (FOS)    05171 Coronavirus disease - COVID-19     121032071 (FOS)    05162 Measles     121032071 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     121032071 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     121032071 (FOS)    05135 Yersinia infection     121032071 (FOS)    05133 Pertussis     121032071 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     121032071 (FOS)    05142 Chagas disease     121032071 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     121032071 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     121032071 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121032071 (FOS)    05418 Fluid shear stress and atherosclerosis     121032071 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     121032071 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     121032071 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pyu03000]     121032071 (FOS)    04131 Membrane trafficking [BR:pyu04131]     121032071 (FOS) Transcription factors [BR:pyu03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     121032071 (FOS) Membrane trafficking [BR:pyu04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     121032071 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  121032071 NCBI-ProteinID:  XP_040333680 LinkDB All DBs Position Unknown AA seq 381 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYSRAGVVKTVTAGGR AQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSAL QTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAF TLPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFY AADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCGAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcctgtcaatgcgcaggacttctgcacggatctggccgtctccagcgccaacttt atcccaacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggctccttctcagaccagagccccccacccctatggagtccccgcc ccctccgccggggcttactccagggctggagtcgtgaagaccgtgaccgcaggaggccga gctcagagcattggcaggaggggcaaagtggaacagttgtccccagaagaagaagagaaa aggagaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccggaggcgg gagctcacggatacgctgcaagcggagacagaccaactagaagatgagaagtctgctttg cagactgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagct caccgacccgcctgcaagatccccgatgacctgggcttcccggaagagatgtctgtggct tccctagatctgagcgggggcctgccggaagctgccacccccgagtcggaggaggctttc accctgcccctcctcaatgatcctgagcccaagccctccgtggagccggtcaagagcatc agcagcatggagctgaaggccgagccctttgatgacttcctgttcccagcatcgtccagg cccagcggctccgagaccgcccgctctgtgccagacatggacctgtctggttccttctat gcagcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagag ctggagcctctgtgcaccccggtggtcacctgtactcctagctgcactacttatacgtct tccttcgtcttcacctaccctgaggctgactccttccccagctgtggggctgctcaccgc aagggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggcc ctgtga

DBGET integrated database retrieval system