Herpailurus yagouaroundi (jaguarundi): 121032687 Help Entry 121032687         CDS       T07555                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu01521   EGFR tyrosine kinase inhibitor resistance pyu01522   Endocrine resistance pyu01524   Platinum drug resistance pyu04064   NF-kappa B signaling pathway pyu04066   HIF-1 signaling pathway pyu04071   Sphingolipid signaling pathway pyu04115   p53 signaling pathway pyu04140   Autophagy - animal pyu04141   Protein processing in endoplasmic reticulum pyu04151   PI3K-Akt signaling pathway pyu04210   Apoptosis pyu04215   Apoptosis - multiple species pyu04217   Necroptosis pyu04261   Adrenergic signaling in cardiomyocytes pyu04340   Hedgehog signaling pathway pyu04510   Focal adhesion pyu04621   NOD-like receptor signaling pathway pyu04630   JAK-STAT signaling pathway pyu04722   Neurotrophin signaling pathway pyu04725   Cholinergic synapse pyu04915   Estrogen signaling pathway pyu04928   Parathyroid hormone synthesis, secretion and action pyu04933   AGE-RAGE signaling pathway in diabetic complications pyu05014   Amyotrophic lateral sclerosis pyu05022   Pathways of neurodegeneration - multiple diseases pyu05132   Salmonella infection pyu05145   Toxoplasmosis pyu05152   Tuberculosis pyu05161   Hepatitis B pyu05162   Measles pyu05168   Herpes simplex virus 1 infection pyu05169   Epstein-Barr virus infection pyu05170   Human immunodeficiency virus 1 infection pyu05200   Pathways in cancer pyu05206   MicroRNAs in cancer pyu05207   Chemical carcinogenesis - receptor activation pyu05210   Colorectal cancer pyu05215   Prostate cancer pyu05222   Small cell lung cancer pyu05226   Gastric cancer pyu05417   Lipid and atherosclerosis pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121032687 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     121032687 (BCL2)    04630 JAK-STAT signaling pathway     121032687 (BCL2)    04064 NF-kappa B signaling pathway     121032687 (BCL2)    04066 HIF-1 signaling pathway     121032687 (BCL2)    04071 Sphingolipid signaling pathway     121032687 (BCL2)    04151 PI3K-Akt signaling pathway     121032687 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121032687 (BCL2)   09143 Cell growth and death    04210 Apoptosis     121032687 (BCL2)    04215 Apoptosis - multiple species     121032687 (BCL2)    04217 Necroptosis     121032687 (BCL2)    04115 p53 signaling pathway     121032687 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     121032687 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     121032687 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     121032687 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     121032687 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     121032687 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     121032687 (BCL2)    04722 Neurotrophin signaling pathway     121032687 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121032687 (BCL2)    05206 MicroRNAs in cancer     121032687 (BCL2)    05207 Chemical carcinogenesis - receptor activation     121032687 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     121032687 (BCL2)    05226 Gastric cancer     121032687 (BCL2)    05215 Prostate cancer     121032687 (BCL2)    05222 Small cell lung cancer     121032687 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121032687 (BCL2)    05161 Hepatitis B     121032687 (BCL2)    05162 Measles     121032687 (BCL2)    05168 Herpes simplex virus 1 infection     121032687 (BCL2)    05169 Epstein-Barr virus infection     121032687 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     121032687 (BCL2)    05152 Tuberculosis     121032687 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     121032687 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121032687 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     121032687 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121032687 (BCL2)    05418 Fluid shear stress and atherosclerosis     121032687 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     121032687 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     121032687 (BCL2)    01524 Platinum drug resistance     121032687 (BCL2)    01522 Endocrine resistance     121032687 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pyu01009]     121032687 (BCL2) Protein phosphatases and associated proteins [BR:pyu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      121032687 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Bcl-2_3 Motif Other DBs NCBI-GeneID:  121032687 NCBI-ProteinID:  XP_040334414 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search AAAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATV VEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNG GWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt gccgccgccgccgccgccgccgccgcgggccctgcgctcagccccgtgccacctgtggtc cacctgaccctgcgccaggccggcgatgacttctcccgtcgctaccgccgcgacttcgcg gagatgtccagccagctgcacctgacaccctttaccgcaaggggacgctttgccacggtg gtggaggagctcttcagggatggagtgaactgggggaggattgtggccttctttgagttc ggtggggtcatgtgtgtggagagcgtcaaccgagagatgtcgcccctggtggacaacatc gccctgtggatgactgagtacctgaaccggcacctgcacacctggatccaagacaacgga ggctgggatgcctttgtggaactgtacggccccagcatgcagcctctgtttgatttctcc tggctgtccctgaaggccctgctcagtctggccctggtgggggcttgcatcaccctgggt gcctatctgggccacaagtga

DBGET integrated database retrieval system