Herpailurus yagouaroundi (jaguarundi): 121040776 Help Entry 121040776         CDS       T07555                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu04010   MAPK signaling pathway pyu04014   Ras signaling pathway pyu04015   Rap1 signaling pathway pyu04024   cAMP signaling pathway pyu04062   Chemokine signaling pathway pyu04510   Focal adhesion pyu04517   IgSF CAM signaling pyu04520   Adherens junction pyu04611   Platelet activation pyu04670   Leukocyte transendothelial migration pyu04720   Long-term potentiation pyu04722   Neurotrophin signaling pathway pyu04934   Cushing syndrome pyu04972   Pancreatic secretion pyu05211   Renal cell carcinoma pyu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121040776 (RAP1B)    04014 Ras signaling pathway     121040776 (RAP1B)    04015 Rap1 signaling pathway     121040776 (RAP1B)    04024 cAMP signaling pathway     121040776 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     121040776 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     121040776 (RAP1B)    04520 Adherens junction     121040776 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     121040776 (RAP1B)    04670 Leukocyte transendothelial migration     121040776 (RAP1B)    04062 Chemokine signaling pathway     121040776 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     121040776 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     121040776 (RAP1B)    04722 Neurotrophin signaling pathway     121040776 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     121040776 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121040776 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     121040776 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pyu04147]     121040776 (RAP1B)    04031 GTP-binding proteins [BR:pyu04031]     121040776 (RAP1B) Exosome [BR:pyu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121040776 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    121040776 (RAP1B)   Exosomal proteins of colorectal cancer cells    121040776 (RAP1B) GTP-binding proteins [BR:pyu04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     121040776 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  121040776 NCBI-ProteinID:  XP_040347416 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKTRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagttgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttaccgcaatgagggatttatacatgaaaaacggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcaaatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataaatgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaat tgtgcattcttagaatcctccgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaagacccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system