Puma yagouaroundi (jaguarundi): 121041076 Help Entry 121041076         CDS       T07555                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu03050   Proteasome pyu04060   Cytokine-cytokine receptor interaction pyu04066   HIF-1 signaling pathway pyu04217   Necroptosis pyu04350   TGF-beta signaling pathway pyu04380   Osteoclast differentiation pyu04612   Antigen processing and presentation pyu04630   JAK-STAT signaling pathway pyu04650   Natural killer cell mediated cytotoxicity pyu04657   IL-17 signaling pathway pyu04658   Th1 and Th2 cell differentiation pyu04659   Th17 cell differentiation pyu04660   T cell receptor signaling pathway pyu04940   Type I diabetes mellitus pyu05140   Leishmaniasis pyu05142   Chagas disease pyu05143   African trypanosomiasis pyu05144   Malaria pyu05145   Toxoplasmosis pyu05146   Amoebiasis pyu05152   Tuberculosis pyu05160   Hepatitis C pyu05164   Influenza A pyu05168   Herpes simplex virus 1 infection pyu05200   Pathways in cancer pyu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pyu05321   Inflammatory bowel disease pyu05322   Systemic lupus erythematosus pyu05323   Rheumatoid arthritis pyu05330   Allograft rejection pyu05332   Graft-versus-host disease pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     121041076 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     121041076 (IFNG)    04630 JAK-STAT signaling pathway     121041076 (IFNG)    04066 HIF-1 signaling pathway     121041076 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121041076 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121041076 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     121041076 (IFNG)    04612 Antigen processing and presentation     121041076 (IFNG)    04660 T cell receptor signaling pathway     121041076 (IFNG)    04658 Th1 and Th2 cell differentiation     121041076 (IFNG)    04659 Th17 cell differentiation     121041076 (IFNG)    04657 IL-17 signaling pathway     121041076 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     121041076 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121041076 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121041076 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     121041076 (IFNG)    05164 Influenza A     121041076 (IFNG)    05168 Herpes simplex virus 1 infection     121041076 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     121041076 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     121041076 (IFNG)    05144 Malaria     121041076 (IFNG)    05145 Toxoplasmosis     121041076 (IFNG)    05140 Leishmaniasis     121041076 (IFNG)    05142 Chagas disease     121041076 (IFNG)    05143 African trypanosomiasis     121041076 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     121041076 (IFNG)    05323 Rheumatoid arthritis     121041076 (IFNG)    05321 Inflammatory bowel disease     121041076 (IFNG)    05330 Allograft rejection     121041076 (IFNG)    05332 Graft-versus-host disease     121041076 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     121041076 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     121041076 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:pyu03051]     121041076 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121041076 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:pyu00536]     121041076 (IFNG) Proteasome [BR:pyu03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     121041076 (IFNG) Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Interferons    121041076 (IFNG) Glycosaminoglycan binding proteins [BR:pyu00536]  Heparan sulfate / Heparin   Cytokines    121041076 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma COG6_C Motif Other DBs NCBI-GeneID:  121041076 NCBI-ProteinID:  XP_040347775 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search MNYTSFIFAFQLCIILCSSGYYCQAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWK EESDKTIIQSQIVSFYLKMFENLKDDDQRIQRSMDTIKEDMLDKLLNTSSSKRDDFLKLI QIPVNDLQVQRKAINELFKVMNDLSPGSNLRKRKRSQNLFRGRRASK NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgaattacacaagttttattttcgcttttcagctttgcataattttgtgttcttctggt tattactgtcaggccatgttttttaaagaaatagaagagctaaagggatattttaatgca agtaatccagatgtagcagatggtgggtcgcttttcgtagacattttgaagaactggaaa gaggagagtgataaaacaataattcaaagccaaattgtctccttctacctgaaaatgttt gaaaatctgaaagatgatgaccagcgcattcaaaggagcatggacaccatcaaggaagac atgcttgataagttgttaaataccagctccagtaaacgggatgacttcctcaagctgatt caaatccctgtgaatgatctgcaggtccagcgcaaagcaataaatgaactcttcaaagtg atgaatgatctctcaccaggatctaacctgaggaagcggaaaaggagtcagaatctgttt cgaggccgtagagcatcgaaataa

DBGET integrated database retrieval system