Quercus lobata (valley oak): 115969583 Help Entry 115969583         CDS       T07350                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism qlo  Quercus lobata (valley oak) Pathway qlo03420   Nucleotide excision repair qlo04120   Ubiquitin mediated proteolysis qlo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:qlo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115969583    04120 Ubiquitin mediated proteolysis     115969583   09124 Replication and repair    03420 Nucleotide excision repair     115969583  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:qlo04121]     115969583    03400 DNA repair and recombination proteins [BR:qlo03400]     115969583 Enzymes [BR:qlo01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      115969583 Ubiquitin system [BR:qlo04121]  Ubiquitin ligases (E3)   UBL E3 ligases    115969583   Multi subunit type E3    SCF complex     Ring finger protein      115969583    Cul2 complex      115969583    Cul3 complex      115969583    Cul4 complex      115969583    Cul7 complex      115969583    Cul8 complex      115969583    Cul9 complex      115969583 DNA repair and recombination proteins [BR:qlo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       115969583     TCR (transcription coupled repair) factors      Cul4-CSA complex       115969583 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  115969583 NCBI-ProteinID:  XP_030945117 LinkDB All DBs Position 11:952977..956911 Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMVPVGEASSSAGPSSSKKNKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcgaccttggattccgacgtgccgatggtcccagtcggcgaggcttcgagcagtgcc ggaccttcttcctcaaagaagaacaagcgtttcgagatcaagaagtggaacgcagtcgct ctctgggcctgggatattgtggttgataactgtgcgatttgcaggaaccatatcatggat ctttgcattgagtgccaagcgaaccaggctagcgctacaagtgaggaatgtacagttgct tggggggtttgcaatcatgcctttcatttccactgcatcagtagatggctcaagactcgt caagtgtgcccattagataacagcgaatgggagtttcaaaagtatggtcattag

DBGET integrated database retrieval system