Quillaja saponaria (soapbark tree): O6P43_027535 Help Entry O6P43_027535      CDS       T09778                                  Name (GenBank) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism qsa  Quillaja saponaria (soapbark tree) Pathway qsa03420   Nucleotide excision repair qsa04120   Ubiquitin mediated proteolysis qsa04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:qsa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     O6P43_027535    04120 Ubiquitin mediated proteolysis     O6P43_027535   09124 Replication and repair    03420 Nucleotide excision repair     O6P43_027535  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:qsa04121]     O6P43_027535    03400 DNA repair and recombination proteins [BR:qsa03400]     O6P43_027535 Enzymes [BR:qsa01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      O6P43_027535 Ubiquitin system [BR:qsa04121]  Ubiquitin ligases (E3)   UBL E3 ligases    O6P43_027535   Multi subunit type E3    SCF complex     Ring finger protein      O6P43_027535    Cul2 complex      O6P43_027535    Cul3 complex      O6P43_027535    Cul4 complex      O6P43_027535    Cul7 complex      O6P43_027535    Cul8 complex      O6P43_027535    Cul9 complex      O6P43_027535 DNA repair and recombination proteins [BR:qsa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       O6P43_027535     TCR (transcription coupled repair) factors      Cul4-CSA complex       O6P43_027535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-ProteinID:  KAJ7951497 UniProt:  A0AAD7L560 LinkDB All DBs Position 11 Genome browser AA seq 127 aa AA seqDB search MATPMDTDVIVVPVGEGSSSHPGPSSSSSLASSSTRKPKRFEIKKWNAVSLWAWDIVVDN CAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEW EFQKYGH NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggctacgcctatggacaccgacgttatagtggttcccgttggagagggttcgtcgagt caccctggaccctcttcttcctcttcccttgcttcttcttcgaccaggaaaccaaagcga ttcgaaatcaagaagtggaacgccgtgtctctctgggcatgggatatcgttgtggataac tgtgcaatctgtaggaaccatatcatggatctatgcattgaatgtcaagctaatcaagct agtgctactagcgaagaatgcaccgttgcttggggggtgtgcaaccatgcattccatttc cattgcatcagccgatggctcaaaacacgtcaagtgtgcccactcgacaacagtgagtgg gagtttcagaaatatggccactga

DBGET integrated database retrieval system