Quercus suber (cork oak): 111993014 Help Entry 111993014         CDS       T05868                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism qsu  Quercus suber (cork oak) Pathway qsu03420   Nucleotide excision repair qsu04120   Ubiquitin mediated proteolysis qsu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:qsu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111993014    04120 Ubiquitin mediated proteolysis     111993014   09124 Replication and repair    03420 Nucleotide excision repair     111993014  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:qsu04121]     111993014    03400 DNA repair and recombination proteins [BR:qsu03400]     111993014 Enzymes [BR:qsu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      111993014 Ubiquitin system [BR:qsu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    111993014   Multi subunit type E3    SCF complex     Ring finger protein      111993014    Cul2 complex      111993014    Cul3 complex      111993014    Cul4 complex      111993014    Cul7 complex      111993014    Cul8 complex      111993014    Cul9 complex      111993014 DNA repair and recombination proteins [BR:qsu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       111993014     TCR (transcription coupled repair) factors      Cul4-CSA complex       111993014 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  111993014 NCBI-ProteinID:  XP_023880628 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MATLDSDVPMVPVGEASSSAGPSSSKKNKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcgaccttggattccgacgtgccgatggtcccagtcggcgaggcttcgagcagtgcc ggaccttcttcctcaaagaagaacaagcgtttcgagatcaagaagtggaacgcagtcgct ctctgggcctgggatattgtggttgataactgtgcgatttgcaggaaccatatcatggat ctttgcatcgagtgccaagcgaaccaggctagcgctacaagtgaggaatgtacagttgct tggggggtttgcaatcatgcctttcatttccactgcatcagtagatggctcaagactcgt caagtgtgcccattagataacagcgaatgggagtttcaaaagtatggtcattag

DBGET integrated database retrieval system