Quercus suber (cork oak): 112001674 Help Entry 112001674         CDS       T05868                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism qsu  Quercus suber (cork oak) Pathway qsu03420   Nucleotide excision repair qsu04120   Ubiquitin mediated proteolysis qsu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:qsu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112001674    04120 Ubiquitin mediated proteolysis     112001674   09124 Replication and repair    03420 Nucleotide excision repair     112001674  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:qsu04121]     112001674    03400 DNA repair and recombination proteins [BR:qsu03400]     112001674 Enzymes [BR:qsu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      112001674 Ubiquitin system [BR:qsu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    112001674   Multi subunit type E3    SCF complex     Ring finger protein      112001674    Cul2 complex      112001674    Cul3 complex      112001674    Cul4 complex      112001674    Cul7 complex      112001674    Cul8 complex      112001674    Cul9 complex      112001674 DNA repair and recombination proteins [BR:qsu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       112001674     TCR (transcription coupled repair) factors      Cul4-CSA complex       112001674 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  112001674 NCBI-ProteinID:  XP_023889617 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search METDADTDVTMVPANTEPEAEPASSSSALLASSSSSSFKKNNKRFEIKKWNAVSLWAWDI VVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLD NSEWEFQKYGH NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggaaacagacgcagatacagacgtgaccatggttccagccaacaccgaacccgaggcc gagcccgcctcctcaagctcagcccttctggcttcttcgtcttcctcttcttttaagaaa aacaacaaacgcttcgaaatcaaaaagtggaacgccgtttctctctgggcttgggatatt gtggtggataactgtgccatctgtaggaaccacatcatggatctctgcattgagtgtcag gcgaatcaggctagtgctactagcgaggaatgcactgttgcttggggtgtttgcaaccat gccttccacttccactgcatcagtcgatggttgaaaactcgccaagtttgcccattggac aatagcgagtgggagttccaaaagtatggtcactag

DBGET integrated database retrieval system