Rahnella aquatilis HX2: Q7S_19195 Help Entry Q7S_19195         CDS       T01850                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism raa  Rahnella aquatilis HX2 Pathway raa00670   One carbon pool by folate raa00790   Folate biosynthesis raa01100   Metabolic pathways raa01240   Biosynthesis of cofactors raa04981   Folate transport and metabolism Module raa_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:raa00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Q7S_19195 (folA)    00670 One carbon pool by folate     Q7S_19195 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     Q7S_19195 (folA) Enzymes [BR:raa01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      Q7S_19195 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AFE60048 LinkDB All DBs Position complement(4191434..4191919) Genome browser AA seq 161 aa AA seqDB search MIISLIAALATDRVIGMENAMPWHLPGDLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN IVISSKPGEHEGVTWVTSVDAALAAAGDVEEVMVMGGGRVYEQLLPKANRLYLTHIDAEV EGDTHFPDYEPDDWESTFSEFHDADEQNSHGYCFEILDRRA NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgattattagcctgatcgccgcactggcgaccgatcgcgttattggcatggaaaacgct atgccttggcatttacctggtgatctggcctggtttaagcgtaatacgctcaacaaaccc gtcatcatggggcgaaagacgtttgagtcaatcggacgcccgttgcctggccggctgaat attgtcatcagctctaaaccgggcgagcatgaaggtgtgacctgggtaacgtctgttgac gctgcgctggcggctgccggcgatgtggaagaagtgatggtgatggggggcggccgcgtg tatgagcaactgctgccgaaggccaatcgtttatatctgactcacattgatgccgaagtc gaaggggatacacatttccctgattatgagccggatgactgggaaagcacattcagcgaa ttccacgatgcggatgagcagaactctcatggttattgcttcgaaatccttgatcgccgc gcctga

DBGET integrated database retrieval system