KEGG   Riemerella anatipestifer RA-CH-2: G148_0442
Entry
G148_0442         CDS       T02438                                 
Name
(GenBank) Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
rae  Riemerella anatipestifer RA-CH-2
Pathway
rae00061  Fatty acid biosynthesis
rae00780  Biotin metabolism
rae01100  Metabolic pathways
rae01110  Biosynthesis of secondary metabolites
rae01212  Fatty acid metabolism
rae01240  Biosynthesis of cofactors
Module
rae_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    G148_0442
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    G148_0442
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    G148_0442
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rae01004]
    G148_0442
Enzymes [BR:rae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     G148_0442
Lipid biosynthesis proteins [BR:rae01004]
 Fatty acid synthase
  Component type
   G148_0442
SSDB
Motif
Pfam: adh_short_C2 adh_short KR SDR Epimerase AdoHcyase_NAD Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: AGC39747
LinkDB
Position
complement(451003..451746)
AA seq 247 aa
MRLLEGKVALITGATRGIGKGIAEIFAAQGAQVAFTYAGSVDKAQALEAELNKTTKAKAY
QSDASDYEGSQKLVEEVLAEFGKIDILVNNAGITKDNLMLRMSKEDWDTIIKVNLDSVFN
LTKAVIKPMMKARGGSIVNMTSVVGIKGNAGQANYAASKAGVIGFTKSIALELGSRNIRC
NAIAPGFIETEMTAALDEKTVQGWRETIPLKRGGQPEDVANACVFLGSELSSYVTGQVLN
VDGGMLT
NT seq 744 nt   +upstreamnt  +downstreamnt
atgagattattagaaggaaaagtagccctcattacaggagctaccagaggtataggaaaa
ggtattgccgagattttcgcagcgcaaggagcacaggtggcattcacttatgcagggtct
gtggataaggcacaagctctagaggcagaacttaataagacaaccaaagctaaggcttat
caaagcgatgcttcggattatgaaggctctcaaaagctcgtagaagaagttttagcagag
tttggtaaaatagatattttggttaataatgcagggattaccaaagacaacctaatgttg
cgtatgtctaaagaagattgggatactattataaaggttaatttagactcggtgtttaac
ctaaccaaagctgttatcaaaccaatgatgaaagcaagaggtggttctatcgtcaatatg
acttccgtggtgggtatcaaaggaaatgcaggtcaggcgaattatgcagcctctaaagct
ggggtaatcggatttactaaatctattgcgttagaattaggctccagaaatatccgttgc
aacgccatcgctccaggttttatagaaaccgaaatgacggcggcactagacgaaaaaaca
gtacaaggttggagagaaaccattccgttaaaaagaggaggtcagccagaagatgtagct
aatgcttgtgtgtttttaggtagcgagttatctagctatgttacagggcaggtgcttaat
gtagatggtggaatgcttacctag

DBGET integrated database retrieval system