Rosa chinensis (China rose): 112179375 Help Entry 112179375         CDS       T06020                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism rcn  Rosa chinensis (China rose) Pathway rcn03420   Nucleotide excision repair rcn04120   Ubiquitin mediated proteolysis rcn04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:rcn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112179375    04120 Ubiquitin mediated proteolysis     112179375   09124 Replication and repair    03420 Nucleotide excision repair     112179375  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:rcn04121]     112179375    03400 DNA repair and recombination proteins [BR:rcn03400]     112179375 Enzymes [BR:rcn01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      112179375 Ubiquitin system [BR:rcn04121]  Ubiquitin ligases (E3)   UBL E3 ligases    112179375   Multi subunit type E3    SCF complex     Ring finger protein      112179375    Cul2 complex      112179375    Cul3 complex      112179375    Cul4 complex      112179375    Cul7 complex      112179375    Cul8 complex      112179375    Cul9 complex      112179375 DNA repair and recombination proteins [BR:rcn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       112179375     TCR (transcription coupled repair) factors      Cul4-CSA complex       112179375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  112179375 NCBI-ProteinID:  XP_024173543 LinkDB All DBs Position 1:45049398..45051295 Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMIPVGEGSSSAGPSSTKRPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcgacattggactccgacgtgccgatgatcccggtaggtgagggctccagctctgca ggtccttcctcgaccaagaggcccaagcgatttgagatcaagaagtggaacgccgtcgct ctctgggcctgggatattgttgtggataattgcgccatttgcaggaaccatattatggac ctctgcatcgagtgccaagcgaaccaggcaagtgctacaagtgaggagtgtaccgttgct tggggggtttgtaaccatgccttccacttccactgcataagcagatggctcaagactcgt caagtgtgtcccttggataacagcgagtgggagttccagaagtatggtcactag

DBGET integrated database retrieval system