Ricinus communis (castor bean): 107260878 Help Entry 107260878         CDS       T01087                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism rcu  Ricinus communis (castor bean) Pathway rcu00510   N-Glycan biosynthesis rcu00513   Various types of N-glycan biosynthesis rcu04141   Protein processing in endoplasmic reticulum Module rcu_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:rcu00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     107260878    00513 Various types of N-glycan biosynthesis     107260878  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107260878 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  107260878 NCBI-ProteinID:  XP_015571767 LinkDB All DBs Position 3:28337104..28339665 Genome browser AA seq 76 aa AA seqDB search MAPKAITSPVPVNLYPALALSMLAIGLMVTASFFIYEATSSRRNRSLVKELTTGAIASFF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccaaaagcgatcacgagtccagttcctgtgaatttgtatccagccctagctctc tctatgcttgcgatcggcctcatggttactgcttccttcttcatctatgaagcaacctca tctaggcgaaatcgtagccttgttaaggagcttacaacaggagcaattgcatcatttttt ctgggttttggatcactattcctgctacttgcttctggtgtttatgtttag

DBGET integrated database retrieval system