Ricinus communis (castor bean): 8259356 Help Entry 8259356           CDS       T01087                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism rcu  Ricinus communis (castor bean) Pathway rcu03420   Nucleotide excision repair rcu04120   Ubiquitin mediated proteolysis rcu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:rcu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     8259356    04120 Ubiquitin mediated proteolysis     8259356   09124 Replication and repair    03420 Nucleotide excision repair     8259356  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:rcu04121]     8259356    03400 DNA repair and recombination proteins [BR:rcu03400]     8259356 Enzymes [BR:rcu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      8259356 Ubiquitin system [BR:rcu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    8259356   Multi subunit type E3    SCF complex     Ring finger protein      8259356    Cul2 complex      8259356    Cul3 complex      8259356    Cul4 complex      8259356    Cul7 complex      8259356    Cul8 complex      8259356    Cul9 complex      8259356 DNA repair and recombination proteins [BR:rcu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       8259356     TCR (transcription coupled repair) factors      Cul4-CSA complex       8259356 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 Motif Other DBs NCBI-GeneID:  8259356 NCBI-ProteinID:  XP_048233914 LinkDB All DBs Position 8:complement(6905137..6907487) Genome browser AA seq 116 aa AA seqDB search MDTDVTMVPAGEASSSAAGPSSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggacacagacgtaaccatggttcccgccggcgaggctagctctagcgccgccggacct tcatcttccacaaagaagcctaagcgattcgaaataaaaaagtggaatgctgtcgctctt tgggcctgggatattgttgtggataactgcgcaatttgtagaaaccacatcatggatctc tgtattgagtgccaagcgaatcaagcaagtgctacaagcgaggagtgcactgttgcctgg ggtgtatgcaaccatgctttccacttccactgcatcagtcgatggctcaaaacccgccaa gtgtgccctcttgataatagtgagtgggaattccaaaagtatggccactag

DBGET integrated database retrieval system