KEGG   Rhizorhabdus dicambivorans: CMV14_15590
Entry
CMV14_15590       CDS       T05084                                 
Name
(GenBank) NAD-dependent DNA ligase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
rdi  Rhizorhabdus dicambivorans
Pathway
rdi03030  DNA replication
rdi03410  Base excision repair
rdi03420  Nucleotide excision repair
rdi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rdi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CMV14_15590
   03410 Base excision repair
    CMV14_15590
   03420 Nucleotide excision repair
    CMV14_15590
   03430 Mismatch repair
    CMV14_15590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rdi03032]
    CMV14_15590
   03400 DNA repair and recombination proteins [BR:rdi03400]
    CMV14_15590
Enzymes [BR:rdi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     CMV14_15590
DNA replication proteins [BR:rdi03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     CMV14_15590
DNA repair and recombination proteins [BR:rdi03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     CMV14_15590
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     CMV14_15590
   MMR (mismatch excision repair)
    DNA ligase
     CMV14_15590
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CMV14_15590
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 DNA_ligase_ZBD BRCT Nlig-Ia PTCB-BRCT Bep_C_terminal
Other DBs
NCBI-ProteinID: ATE65651
UniProt: A0A2A4FRF7
LinkDB
Position
3298506..3300632
AA seq 708 aa
MTTESEAAERLAFLAAEIARHNALYHGEDAPEISDADYDALMRENNALEAEYPHLIRADS
PSKLVGATPSGHLAKVAHAQPMLSLDNAFADEDVTEFVERVRRYLKLGDGEPVALTAEPK
IDGLSCSLRYEHGVLVLAATRGDGTTGEDVTANVRTIDDIPQRLKGADLLSEPPAVFEIR
GEVYMAKADFAALNARLLAEAEDPAKARQFANPRNAAAGSLRQKDPSVTASRPLRFLAHG
WGEVSALPADTQKGVIDAIAAWGVPVSDDFVRMDGAEQALSHYRAIEAKRADLPFDIDGV
VYKVDRLDWQKRLGFVARAPRWAIAHKFPAEKAQTLLNDIDIQVGRTGKLTPVARLEPVT
VGGVVVTNATLHNADEIGRLNVWPGDRVVVQRAGDVIPQIVENLSRDEARGPWPFPETCP
ECGSAAEREPGEVDYRCTGGLICPAQRVERLRHFVSRHALDIEGLGITNIENFFRDQLVQ
SPADIFKLTKETLLSRERWAEISANNLIAAIDAKRNPPLDRFLFALGIRHVGEVTARDLA
RRYRSWDALKTVIDRAIEARDAAVQAVGEPDDKYAVRIAKELAAIIETPGVGPEVALALI
DFFAEPHNQEAVADLLSQLQPADVIHETRASAVSGKTVVFTGTLETMSRDEAKAQAEALG
AKVAGSVSAKTDLVVAGPGAGSKLKKASDLGVEVTDEAGWGAIVAAAG
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgaccaccgaatccgaagccgccgaacggctcgccttcctcgccgccgagatcgcgcgg
cacaatgcgctctatcatggcgaggatgcgcccgagatttcggacgccgactatgacgcg
ctgatgcgcgagaacaatgcgctggaggcggaatatccgcacctgatccgcgcggattcg
ccgtcgaagctggttggcgccacgccctcggggcatctcgccaaggtcgctcatgcgcag
ccgatgctcagcctcgacaatgcctttgccgacgaggacgtgaccgagttcgtggagcgg
gtgcgccgctatctgaagctgggcgacggcgaaccggtggcgctcaccgccgaacccaag
atcgatgggctgtcctgctcgctgcgctacgaacatggtgtgctggtgctggcggcgacc
cgcggcgacggcacgaccggcgaggacgtcaccgctaatgtccgcacgatcgacgacatt
ccgcagcggctgaagggtgccgatctgctcagcgaaccgcccgccgtgttcgagattcgg
ggcgaggtctatatggcgaaggcggatttcgccgcgctcaacgcccggctgctcgccgaa
gcggaggacccggccaaggcgcgccagttcgccaatccgcgcaacgccgccgctgggtcg
ctgcgccagaaggatccctcggtgacggcttcacgccccttgcgttttctggcgcatggc
tggggcgaagtctccgccctccccgccgacacccagaaaggcgtgatcgacgccattgca
gcctggggcgtcccggtctcagacgatttcgtccgcatggatggcgcggaacaggcgctc
tcccattatcgcgcgatcgaggcgaagcgtgccgacctgcccttcgatatcgacggtgtc
gtctacaaggtcgaccggctcgactggcagaagcggctcggcttcgtcgcccgcgcgccg
cgctgggcgatcgcgcacaaattcccggccgaaaaggcccagaccctgctcaacgacatc
gacatccaggtcggccgcaccggcaagctgaccccggtggcgcggctggagccggtgacg
gtgggcggcgtcgtcgtcaccaatgcgacgctccataatgccgacgagatcggccgcctc
aacgtgtggccgggggaccgggtggtcgtccagcgcgccggggacgtcatcccgcagatc
gtcgagaatctgtcgcgcgacgaagcgcgcgggccatggccctttcccgagacctgcccc
gaatgcggatcggcggccgagcgggaacccggcgaggtcgattatcgctgcaccggcggg
ctgatctgccccgcccagcgggtcgagcggctgcgccatttcgtttcgcgccacgcactc
gacatcgaggggctgggcatcaccaatatcgagaatttcttcagggaccagctcgttcag
tctccggccgacattttcaaactgacgaaggaaaccctgctaagtcgtgaacgttgggcc
gaaatttcagccaacaatctgattgccgcgatcgatgccaaacgcaatccgccgctcgac
cgcttcctgttcgcgctgggcatccgccatgtcggcgaggtgaccgcacgcgatctggcc
cgccgctatcgcagctgggacgcgctcaagacggtgatcgatcgcgcgatcgaagcgcgc
gacgcggcggtgcaggcggtgggggaacccgacgacaaatatgcggtccgcattgccaag
gaactggcggcgatcatcgagacgccaggcgtaggccccgaagtggcgctggcgctgatc
gacttcttcgccgagccgcacaatcaggaggcggtggccgatctgctgtcgcagctccag
cccgccgacgtgatccacgagacgcgggcttcggcggtgagcggcaagacagtggtgttc
accggcacgcttgagacgatgtcgcgcgacgaggcgaaggcccaggccgaggcgctcggc
gccaaggtggcaggatcggtgtcggccaagaccgacctggtcgtcgcggggccgggcgcg
ggatcgaaactgaagaaggcgagcgacctgggtgtcgaggtgaccgacgaggcgggctgg
ggcgcgatcgtggcggcggcggggtga

DBGET integrated database retrieval system