Cupriavidus necator H16: H16_A0259 Help Entry H16_A0259         CDS       T00416                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism reh  Cupriavidus necator H16 Pathway reh00790   Folate biosynthesis reh01100   Metabolic pathways reh01240   Biosynthesis of cofactors Module reh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:reh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     H16_A0259 (folB) Enzymes [BR:reh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      H16_A0259 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      H16_A0259 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      H16_A0259 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF3734 Motif Other DBs NCBI-ProteinID:  CAJ91411 UniProt:  Q0KF10 LinkDB All DBs Position 1:269644..270045 Genome browser AA seq 133 aa AA seqDB search MTMLAALSHPSLQDCRRMFLRNYEVQINIGVHEFEKKGEQRVLINIDLFVPLAQSTPQAD KLDEVVDYDFMRNTVAERMAQGHVHLQETLCDDVARAMLKHPKVRAVRVSTEKPDVYPDC DSVGVEVFHIKQA NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgaccatgctcgccgccctttcccaccccagcctgcaagactgccgacgcatgttcctg cgcaactacgaagtgcagatcaatatcggcgtgcacgaattcgagaagaagggcgaacag cgggtgctaatcaatatcgacctgttcgtgccgctggcgcagagcaccccgcaggccgac aagctcgacgaagtggtcgactacgacttcatgcgcaacaccgtggccgagcgcatggcg cagggccacgtgcacctgcaggaaaccttgtgcgacgacgtcgcgcgcgccatgctgaag catcccaaggtgcgcgcggtgcgtgtctcgaccgagaagcccgacgtgtacccggactgc gattcggtcggcgtcgaggtcttccatatcaagcaggcctga

DBGET integrated database retrieval system