KEGG   Ruminococcus gauvreauii: NQ502_12870
Entry
NQ502_12870       CDS       T08490                                 
Name
(GenBank) SDR family oxidoreductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
rgv  Ruminococcus gauvreauii
Pathway
rgv00061  Fatty acid biosynthesis
rgv00780  Biotin metabolism
rgv01100  Metabolic pathways
rgv01110  Biosynthesis of secondary metabolites
rgv01212  Fatty acid metabolism
rgv01240  Biosynthesis of cofactors
Module
rgv_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rgv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NQ502_12870
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NQ502_12870
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NQ502_12870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rgv01004]
    NQ502_12870
Enzymes [BR:rgv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     NQ502_12870
Lipid biosynthesis proteins [BR:rgv01004]
 Fatty acid synthase
  Component type
   NQ502_12870
SSDB
Motif
Pfam: adh_short_C2 adh_short KR SDR 3HCDH_N DUF2855
Other DBs
NCBI-ProteinID: UWP58269
UniProt: A0ABY5VCH1
LinkDB
Position
2673072..2673848
AA seq 258 aa
MKLDGKIAIVTGAAQGIGRGIALEYAKNGADLMITDINHEKLVNVCEEIRLLGRKCIFLT
GDVARSEDVRNVVNSTRKAYGRIDILTHAAGILRSCPVIEQEEEDWDAVINVNLRSTFLY
CKYVGREMKRQGSGKMVLIDSCASKTGEAFNAVYCASKAGVRLLSQSLALELAEYGINVN
SIAPGTINTEMISRCLHDRAPLYGLSYEEYLKEFNEATPLKRMGEPEEIGKLCVFLASDD
AAFITGSSFNISGGRENH
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaagcttgatggtaaaattgcgatcgttaccggtgctgcacagggaatcggccgcggc
attgcactggaatacgctaaaaacggtgcagatctgatgataacggatatcaatcacgag
aaattggtgaacgtctgtgaggagataaggttattgggaagaaaatgcatatttctgaca
ggggatgtcgctaggagcgaagacgtcagaaatgtagtaaacagtacacgaaaagcctat
gggcgaatcgatatactgactcatgctgccgggattttacgttcctgtccggtcatcgaa
caggaggaagaggactgggatgctgtgatcaacgtcaacctcaggagtacatttctatac
tgtaagtacgtcggcagggaaatgaaaagacagggttccggaaaaatggtattgattgac
tcctgcgcttcaaaaacaggagaggcatttaatgcagtgtattgtgcttcaaaagcgggg
gtcaggcttttgtcacagtctttggcactggaacttgcagaatacgggattaatgtaaac
agtatagctcccgggacgatcaatacggagatgatcagcagatgcctgcatgaccgggcg
cctttgtacggactcagctatgaggaatacttaaaagagtttaacgaggcgactccgctg
aagagaatgggagagccggaggagatcggcaaattgtgtgtattcctggcgtctgatgac
gcggcatttattaccgggtcatcgtttaatatttcaggcggacgggaaaatcattga

DBGET integrated database retrieval system