Rhizobium sp. AB2/73: I8E17_08470 Help Entry I8E17_08470       CDS       T10377                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism rhib  Rhizobium sp. AB2/73 Pathway rhib00790   Folate biosynthesis rhib01100   Metabolic pathways rhib01240   Biosynthesis of cofactors Module rhib_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:rhib00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     I8E17_08470 (folB) Enzymes [BR:rhib01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      I8E17_08470 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      I8E17_08470 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      I8E17_08470 (folB) SSDB OrthologParalogGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  UEQ82516 LinkDB All DBs Position complement(1683633..1684004) Genome browser AA seq 123 aa AA seqDB search MSAVTYTITLQNCAFFARHGVHDEEEFLGQRFFVDAELDVEAGDALERDSIDDTVNYGIA FSVIEEIVTGRRRYLIEALALDVAKELCRRFPGIRRAKITVRKPNAPVPGVLDYVQVSIE HFA NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgagcgctgtgacatacaccattactttgcagaattgcgccttctttgcccggcacggc gtccatgacgaggaggaattccttggccagcgcttcttcgtcgatgccgaactcgatgtc gaagccggcgatgcgctggagcgtgattcgatcgacgacaccgtcaattacggcatcgca ttcagcgtcatcgaggaaatcgtgaccgggcgccgacgctatctgatcgaggcgctggcg cttgatgtggcgaaggaactatgccgtcgttttccgggtatccgccgcgccaaaatcacg gtacgcaagcccaatgccccggttccgggcgttctcgattatgtgcaggtgagcattgag cattttgcctga

DBGET integrated database retrieval system