Ralstonia mannitolilytica: TK49_09490
Help
Entry
TK49_09490 CDS
T03778
Symbol
fabG
Name
(GenBank) 3-ketoacyl-ACP reductase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
rmn
Ralstonia mannitolilytica
Pathway
rmn00061
Fatty acid biosynthesis
rmn00780
Biotin metabolism
rmn01100
Metabolic pathways
rmn01110
Biosynthesis of secondary metabolites
rmn01212
Fatty acid metabolism
rmn01240
Biosynthesis of cofactors
Module
rmn_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
rmn00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
TK49_09490 (fabG)
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
TK49_09490 (fabG)
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
TK49_09490 (fabG)
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
rmn01004
]
TK49_09490 (fabG)
Enzymes [BR:
rmn01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
TK49_09490 (fabG)
Lipid biosynthesis proteins [BR:
rmn01004
]
Fatty acid synthase
Component type
TK49_09490 (fabG)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
SDR
DUF1776
Epimerase
Seadorna_Vp10
Motif
Other DBs
NCBI-ProteinID:
AJW44920
UniProt:
A0AAJ4ZLQ5
LinkDB
All DBs
Position
1:1991223..1991972
Genome browser
AA seq
249 aa
AA seq
DB search
MTQALNNQVALVTGASRGIGRAIALELARQGATVVGTATSEGGAQAITAYFAEAGLKGAG
VVLNVNDAARCESVIDETIKTHGGLNILVNNAGITQDNLAMRMKDEEWVSVIDTNLSAVF
RLSRAVLRPMMKARGGRIINITSVVGSAGNPGQANYAAAKAGVEGMARALAREIGSRNIT
VNCIAPGFIDTDMTKVLSEEQHTALKAQIPLGRLGAPEDIASAVAFLASPAAGYITGSTL
HVNGGMYMG
NT seq
750 nt
NT seq
+upstream
nt +downstream
nt
atgacccaagcattgaacaaccaggtcgcgctcgtcacgggcgcttcgcgcggcattggc
cgtgccattgcgctggaactggcgcgccagggtgcgacggtggtcggcacggccacgtcg
gagggcggtgcgcaggccatcacggcttactttgccgaagccggcctgaagggtgcgggc
gtggtgctcaacgtgaacgacgccgcgcgctgtgaaagcgtcattgacgaaaccatcaag
acgcatggcgggctcaacatcctcgtcaacaatgccggcatcacgcaggacaaccttgcg
atgcgcatgaaggatgaggagtgggtctccgtcatcgatacgaacctctccgcggtgttc
cgcctctcgcgcgccgtgctgcgcccgatgatgaaggcgcgcggcggtcgcatcatcaac
atcacgtcggtggtagggtcggcgggcaacccgggccaggccaactacgcggcggccaag
gctggtgtggagggcatggcgcgcgcactagcccgcgagatcggcagccgcaatatcacg
gtgaactgcatcgcgccgggctttattgataccgacatgacgaaggttctgtcggaggag
caacataccgcgctgaaggcgcagattccgctgggccgcctgggtgcgcccgaggacatc
gccagcgcggtcgccttcctggcgtcgccggcggcgggctacattacgggctcgacgctg
cacgtcaacggcggcatgtacatgggataa
DBGET
integrated database retrieval system