KEGG   Rattus norvegicus (rat): 100049583
Entry
100049583         CDS       T01003                                 
Symbol
Trex1
Name
(RefSeq) three-prime repair exonuclease 1
  KO
K10790  three prime repair exonuclease 1 [EC:3.1.11.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    100049583 (Trex1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    100049583 (Trex1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     100049583 (Trex1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Nucleases
    100049583 (Trex1)
SSDB
Motif
Pfam: RNase_T RNase_H_2
Other DBs
NCBI-GeneID: 100049583
NCBI-ProteinID: NP_001020160
RGD: 1311998
Ensembl: ENSRNOG00000022540
UniProt: Q5BK16
LinkDB
Position
8:complement(109706613..109707913)
AA seq 316 aa
MGSQALPHGHMQTLIFLDLEATGLPYSQPKITELCLLAVHRHALENSSMSEGQPPPVPKP
PRVVDKLSLCIAPGKPCSSGASEITGLTTAGLEAHGRQRFNDNLATLLQVFLQRQPQPCC
LVAHNGDRYDFPLLQAELASLSVISPLDGTFCVDSIAALKTLEQASSPSEHGPRKSYSLG
SIYTRLYGQAPTDSHTAEGDVLALLSICQWKPQALLQWVDKHARPFSTIKPMYGMAATTG
TASPRLCAATTSSPLATANLSPSNGRSRGKRPTSPPPENVPEAPSREGLLAPLGLLTFLT
LAIAVLYGIFLASPGQ
NT seq 951 nt   +upstreamnt  +downstreamnt
atgggctcacaggccctgccccacggtcacatgcagaccctcatcttcttagacctggaa
gccactggcctgccttactctcagcccaaaatcacagagctgtgcctgctggctgtccac
agacatgccctggagaactcctccatgtctgaggggcagccacctccggtgcccaaacca
ccccgtgtggtggacaagctctctctctgcattgctccagggaaaccctgcagttctggg
gccagtgagatcacaggtctgaccacagctgggctggaagcacacgggcgtcaacgcttc
aatgacaacctggccaccctgctccaagtcttcctgcagcgccagccacagccctgctgc
cttgtggcccacaacggtgaccgctacgactttcctctgctccaggcagagcttgcttcg
ctgagcgttatcagtcctctggacggtaccttctgtgtggatagcatcgctgccctgaag
accttggagcaagccagcagcccctcagagcatggtccgaggaaaagctatagcctgggt
agtatctacacccgcctgtacgggcaagcaccaacagactcacacactgctgaaggcgac
gttctagccctgctcagcatctgtcagtggaagccacaggccctactgcagtgggtggac
aaacacgcccggccctttagcaccatcaagcccatgtatggcatggcagctactactgga
acggccagcccaaggctgtgtgctgccacaacctcctcacccctggccacagccaactta
agtcccagcaatggcaggagcaggggcaagcgacctacgagtcctcctccagagaacgtc
ccagaagccccatcacgggaggggctgctggccccactgggcctgctgaccttcctgacc
ttggcaatagccgttctgtatggaatcttcctggcctcacctgggcagtaa

DBGET integrated database retrieval system