Rattus norvegicus (rat): 100361457 Help Entry 100361457         CDS       T01003                                  Symbol Actg1l1 Name (RefSeq) actin, gamma 1 propeptide-like   KO K05692   actin beta/gamma 1 Organism rno  Rattus norvegicus (rat) Pathway rno03082   ATP-dependent chromatin remodeling rno04015   Rap1 signaling pathway rno04145   Phagosome rno04210   Apoptosis rno04390   Hippo signaling pathway rno04510   Focal adhesion rno04520   Adherens junction rno04530   Tight junction rno04611   Platelet activation rno04613   Neutrophil extracellular trap formation rno04670   Leukocyte transendothelial migration rno04714   Thermogenesis rno04810   Regulation of actin cytoskeleton rno04814   Motor proteins rno04820   Cytoskeleton in muscle cells rno04919   Thyroid hormone signaling pathway rno04921   Oxytocin signaling pathway rno04971   Gastric acid secretion rno05014   Amyotrophic lateral sclerosis rno05100   Bacterial invasion of epithelial cells rno05132   Salmonella infection rno05135   Yersinia infection rno05164   Influenza A rno05205   Proteoglycans in cancer rno05225   Hepatocellular carcinoma rno05410   Hypertrophic cardiomyopathy rno05412   Arrhythmogenic right ventricular cardiomyopathy rno05414   Dilated cardiomyopathy rno05416   Viral myocarditis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100361457 (Actg1l1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100361457 (Actg1l1)    04390 Hippo signaling pathway     100361457 (Actg1l1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100361457 (Actg1l1)   09143 Cell growth and death    04210 Apoptosis     100361457 (Actg1l1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100361457 (Actg1l1)    04520 Adherens junction     100361457 (Actg1l1)    04530 Tight junction     100361457 (Actg1l1)   09142 Cell motility    04814 Motor proteins     100361457 (Actg1l1)    04820 Cytoskeleton in muscle cells     100361457 (Actg1l1)    04810 Regulation of actin cytoskeleton     100361457 (Actg1l1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100361457 (Actg1l1)    04613 Neutrophil extracellular trap formation     100361457 (Actg1l1)    04670 Leukocyte transendothelial migration     100361457 (Actg1l1)   09152 Endocrine system    04921 Oxytocin signaling pathway     100361457 (Actg1l1)    04919 Thyroid hormone signaling pathway     100361457 (Actg1l1)   09154 Digestive system    04971 Gastric acid secretion     100361457 (Actg1l1)   09159 Environmental adaptation    04714 Thermogenesis     100361457 (Actg1l1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100361457 (Actg1l1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100361457 (Actg1l1)   09172 Infectious disease: viral    05164 Influenza A     100361457 (Actg1l1)   09171 Infectious disease: bacterial    05132 Salmonella infection     100361457 (Actg1l1)    05135 Yersinia infection     100361457 (Actg1l1)    05100 Bacterial invasion of epithelial cells     100361457 (Actg1l1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100361457 (Actg1l1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100361457 (Actg1l1)    05410 Hypertrophic cardiomyopathy     100361457 (Actg1l1)    05412 Arrhythmogenic right ventricular cardiomyopathy     100361457 (Actg1l1)    05414 Dilated cardiomyopathy     100361457 (Actg1l1)    05416 Viral myocarditis     100361457 (Actg1l1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:rno03021]     100361457 (Actg1l1)    03019 Messenger RNA biogenesis [BR:rno03019]     100361457 (Actg1l1)    03036 Chromosome and associated proteins [BR:rno03036]     100361457 (Actg1l1)    03029 Mitochondrial biogenesis [BR:rno03029]     100361457 (Actg1l1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:rno04812]     100361457 (Actg1l1)    04147 Exosome [BR:rno04147]     100361457 (Actg1l1) Transcription machinery [BR:rno03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      100361457 (Actg1l1) Messenger RNA biogenesis [BR:rno03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100361457 (Actg1l1) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      100361457 (Actg1l1)     NuA4 complex      100361457 (Actg1l1)   Chromatin remodeling factors    BAF complex     100361457 (Actg1l1)    PBAF complex     100361457 (Actg1l1)    GBAF(ncBAF) complex     100361457 (Actg1l1)    SWR1 complex     100361457 (Actg1l1) Mitochondrial biogenesis [BR:rno03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     100361457 (Actg1l1) Cytoskeleton proteins [BR:rno04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      100361457 (Actg1l1) Exosome [BR:rno04147]  Exosomal proteins   Proteins found in most exosomes    100361457 (Actg1l1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  100361457 NCBI-ProteinID:  NP_001396275 RGD:  2320108 LinkDB All DBs Position 3:93434045..93435969 Genome browser AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaagaaatcgccgccctcgtcattgacaatggctccggcatgtgcaaagctggc tttgctggggacgacgcccccagggccgtgtttccttccatcgtcgggcgcccccgacac cagggtgtcatggtgggcatgggccagaaagactcgtacgtgggtgatgaggcccagagc aagaggggtattctgaccctgaagtaccctattgagcacggcattgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccctgaggag cacccggtgcttctgaccgaggcccccctgaaccccaaagctaacagagagaagatgacg cagataatgtttgaaaccttcaataccccagccatgtacgtggccattcaggcggtgctc tccttgtatgcatctgggcgtaccactggcattgtcatggactctggtgacggggtcaca cacacagtgcccatctatgagggctacgcccttccccacgccatcttgcgtctggacctg gctggccgggacctgacagactacctcatgaagatcctgactgaaaggggctacagcttt accaccactgctgagagggaaattgttcgtgacataaaggagaagctgtgctatgttgcc ctggattttgagcaagaaatggctactgctgcatcatcttcctctttggagaagagttat gagctgcctgatgggcaggtgatcaccattggcaatgagcgcttccggtgtccagaggct ctcttccagccttccttcctgggcatggagtcctgtggcatccacgagaccaccttcaac tccatcatgaagtgtgatgtggacatccgcaaagacctgtatgccaacacagtgctgtct ggtggtaccaccatgtatccaggcattgctgacaggatgcagaaggagatcacagccctg gctcccagcacaatgaagattaagatcattgctcctcctgaacgcaagtactcagtctgg attggcggctccatcctggcctcactgtccaccttccagcagatgtggatcagcaagcag gagtatgacgagtcaggcccctccattgtccaccgcaaatgcttctag

DBGET integrated database retrieval system