Rattus norvegicus (rat): 24224 Help Entry 24224             CDS       T01003                                  Symbol Bcl2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism rno  Rattus norvegicus (rat) Pathway rno01521   EGFR tyrosine kinase inhibitor resistance rno01522   Endocrine resistance rno01524   Platinum drug resistance rno04064   NF-kappa B signaling pathway rno04066   HIF-1 signaling pathway rno04071   Sphingolipid signaling pathway rno04115   p53 signaling pathway rno04140   Autophagy - animal rno04141   Protein processing in endoplasmic reticulum rno04151   PI3K-Akt signaling pathway rno04210   Apoptosis rno04215   Apoptosis - multiple species rno04217   Necroptosis rno04261   Adrenergic signaling in cardiomyocytes rno04340   Hedgehog signaling pathway rno04510   Focal adhesion rno04621   NOD-like receptor signaling pathway rno04630   JAK-STAT signaling pathway rno04722   Neurotrophin signaling pathway rno04725   Cholinergic synapse rno04915   Estrogen signaling pathway rno04928   Parathyroid hormone synthesis, secretion and action rno04933   AGE-RAGE signaling pathway in diabetic complications rno05014   Amyotrophic lateral sclerosis rno05022   Pathways of neurodegeneration - multiple diseases rno05132   Salmonella infection rno05145   Toxoplasmosis rno05152   Tuberculosis rno05161   Hepatitis B rno05162   Measles rno05168   Herpes simplex virus 1 infection rno05169   Epstein-Barr virus infection rno05170   Human immunodeficiency virus 1 infection rno05200   Pathways in cancer rno05206   MicroRNAs in cancer rno05207   Chemical carcinogenesis - receptor activation rno05210   Colorectal cancer rno05215   Prostate cancer rno05222   Small cell lung cancer rno05226   Gastric cancer rno05417   Lipid and atherosclerosis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     24224 (Bcl2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     24224 (Bcl2)    04630 JAK-STAT signaling pathway     24224 (Bcl2)    04064 NF-kappa B signaling pathway     24224 (Bcl2)    04066 HIF-1 signaling pathway     24224 (Bcl2)    04071 Sphingolipid signaling pathway     24224 (Bcl2)    04151 PI3K-Akt signaling pathway     24224 (Bcl2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     24224 (Bcl2)   09143 Cell growth and death    04210 Apoptosis     24224 (Bcl2)    04215 Apoptosis - multiple species     24224 (Bcl2)    04217 Necroptosis     24224 (Bcl2)    04115 p53 signaling pathway     24224 (Bcl2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     24224 (Bcl2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     24224 (Bcl2)   09152 Endocrine system    04915 Estrogen signaling pathway     24224 (Bcl2)    04928 Parathyroid hormone synthesis, secretion and action     24224 (Bcl2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     24224 (Bcl2)   09156 Nervous system    04725 Cholinergic synapse     24224 (Bcl2)    04722 Neurotrophin signaling pathway     24224 (Bcl2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     24224 (Bcl2)    05206 MicroRNAs in cancer     24224 (Bcl2)    05207 Chemical carcinogenesis - receptor activation     24224 (Bcl2)   09162 Cancer: specific types    05210 Colorectal cancer     24224 (Bcl2)    05226 Gastric cancer     24224 (Bcl2)    05215 Prostate cancer     24224 (Bcl2)    05222 Small cell lung cancer     24224 (Bcl2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     24224 (Bcl2)    05161 Hepatitis B     24224 (Bcl2)    05162 Measles     24224 (Bcl2)    05168 Herpes simplex virus 1 infection     24224 (Bcl2)    05169 Epstein-Barr virus infection     24224 (Bcl2)   09171 Infectious disease: bacterial    05132 Salmonella infection     24224 (Bcl2)    05152 Tuberculosis     24224 (Bcl2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     24224 (Bcl2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     24224 (Bcl2)    05022 Pathways of neurodegeneration - multiple diseases     24224 (Bcl2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     24224 (Bcl2)    05418 Fluid shear stress and atherosclerosis     24224 (Bcl2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     24224 (Bcl2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     24224 (Bcl2)    01524 Platinum drug resistance     24224 (Bcl2)    01522 Endocrine resistance     24224 (Bcl2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:rno01009]     24224 (Bcl2) Protein phosphatases and associated proteins [BR:rno01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      24224 (Bcl2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  24224 NCBI-ProteinID:  NP_058689 RGD:  2199 Vega:  OTTRNOG00000002239 UniProt:  P49950 LinkDB All DBs Position 13:complement(23204464..23366900) Genome browser AA seq 236 aa AA seqDB search MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPA VHRDTAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 711 nt NT seq  +upstreamnt  +downstreamnt atggcgcaagccgggagaacagggtatgataaccgggagatcgtgatgaagtacatccat tataagctgtcacagaggggctacgagtgggatactggagatgaagactccgcgcccctg agggctgcccccacccctggcatcttctccttccagcctgagagcaaccggacgcccgct gtgcaccgagacacggctgccaggacgtcgcctctacggccccttgtcgccaccgctggg cctgcgctcagccctgtgccacctgtggtccacctgaccctccgccgggctggggatgac ttctctcgtcgctaccgtcgcgactttgcagagatgtccagtcagctgcacctgacgccc ttcaccgcgaggggacgctttgccacggtggtggaggaactcttcagggatggggtgaac tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac agggagatgtcacccctggtggacaacatcgctctgtggatgactgagtacctgaaccgg catctgcacacctggatccaggataacggaggctgggatgcctttgtggaactatatggc cccagcatgcgacctctgtttgatttctcctggctgtctctgaagacgctgctcagcctg gccctggtgggggcctgcatcactctgggtgcatacctgggccacaagtga

DBGET integrated database retrieval system