Rattus norvegicus (rat): 24498 Help Entry 24498             CDS       T01003                                  Symbol Il6 Name (RefSeq) interleukin-6 precursor   KO K05405   interleukin 6 Organism rno  Rattus norvegicus (rat) Pathway rno01521   EGFR tyrosine kinase inhibitor resistance rno01523   Antifolate resistance rno04060   Cytokine-cytokine receptor interaction rno04061   Viral protein interaction with cytokine and cytokine receptor rno04066   HIF-1 signaling pathway rno04068   FoxO signaling pathway rno04151   PI3K-Akt signaling pathway rno04218   Cellular senescence rno04620   Toll-like receptor signaling pathway rno04621   NOD-like receptor signaling pathway rno04623   Cytosolic DNA-sensing pathway rno04625   C-type lectin receptor signaling pathway rno04630   JAK-STAT signaling pathway rno04640   Hematopoietic cell lineage rno04657   IL-17 signaling pathway rno04659   Th17 cell differentiation rno04668   TNF signaling pathway rno04672   Intestinal immune network for IgA production rno04931   Insulin resistance rno04932   Non-alcoholic fatty liver disease rno04933   AGE-RAGE signaling pathway in diabetic complications rno04936   Alcoholic liver disease rno05010   Alzheimer disease rno05020   Prion disease rno05022   Pathways of neurodegeneration - multiple diseases rno05132   Salmonella infection rno05133   Pertussis rno05134   Legionellosis rno05135   Yersinia infection rno05142   Chagas disease rno05143   African trypanosomiasis rno05144   Malaria rno05146   Amoebiasis rno05152   Tuberculosis rno05161   Hepatitis B rno05162   Measles rno05163   Human cytomegalovirus infection rno05164   Influenza A rno05166   Human T-cell leukemia virus 1 infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05168   Herpes simplex virus 1 infection rno05169   Epstein-Barr virus infection rno05171   Coronavirus disease - COVID-19 rno05200   Pathways in cancer rno05202   Transcriptional misregulation in cancer rno05321   Inflammatory bowel disease rno05323   Rheumatoid arthritis rno05332   Graft-versus-host disease rno05410   Hypertrophic cardiomyopathy rno05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     24498 (Il6)    04668 TNF signaling pathway     24498 (Il6)    04066 HIF-1 signaling pathway     24498 (Il6)    04068 FoxO signaling pathway     24498 (Il6)    04151 PI3K-Akt signaling pathway     24498 (Il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     24498 (Il6)    04061 Viral protein interaction with cytokine and cytokine receptor     24498 (Il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     24498 (Il6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     24498 (Il6)    04620 Toll-like receptor signaling pathway     24498 (Il6)    04621 NOD-like receptor signaling pathway     24498 (Il6)    04623 Cytosolic DNA-sensing pathway     24498 (Il6)    04625 C-type lectin receptor signaling pathway     24498 (Il6)    04659 Th17 cell differentiation     24498 (Il6)    04657 IL-17 signaling pathway     24498 (Il6)    04672 Intestinal immune network for IgA production     24498 (Il6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     24498 (Il6)    05202 Transcriptional misregulation in cancer     24498 (Il6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     24498 (Il6)    05161 Hepatitis B     24498 (Il6)    05171 Coronavirus disease - COVID-19     24498 (Il6)    05164 Influenza A     24498 (Il6)    05162 Measles     24498 (Il6)    05168 Herpes simplex virus 1 infection     24498 (Il6)    05163 Human cytomegalovirus infection     24498 (Il6)    05167 Kaposi sarcoma-associated herpesvirus infection     24498 (Il6)    05169 Epstein-Barr virus infection     24498 (Il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     24498 (Il6)    05135 Yersinia infection     24498 (Il6)    05133 Pertussis     24498 (Il6)    05134 Legionellosis     24498 (Il6)    05152 Tuberculosis     24498 (Il6)   09174 Infectious disease: parasitic    05146 Amoebiasis     24498 (Il6)    05144 Malaria     24498 (Il6)    05142 Chagas disease     24498 (Il6)    05143 African trypanosomiasis     24498 (Il6)   09163 Immune disease    05323 Rheumatoid arthritis     24498 (Il6)    05321 Inflammatory bowel disease     24498 (Il6)    05332 Graft-versus-host disease     24498 (Il6)   09164 Neurodegenerative disease    05010 Alzheimer disease     24498 (Il6)    05020 Prion disease     24498 (Il6)    05022 Pathways of neurodegeneration - multiple diseases     24498 (Il6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     24498 (Il6)    05410 Hypertrophic cardiomyopathy     24498 (Il6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     24498 (Il6)    04932 Non-alcoholic fatty liver disease     24498 (Il6)    04931 Insulin resistance     24498 (Il6)    04933 AGE-RAGE signaling pathway in diabetic complications     24498 (Il6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     24498 (Il6)    01523 Antifolate resistance     24498 (Il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:rno04052]     24498 (Il6) Cytokines and growth factors [BR:rno04052]  Cytokines   Interleukins    24498 (Il6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL23 Motif Other DBs NCBI-GeneID:  24498 NCBI-ProteinID:  NP_036721 RGD:  2901 Ensembl:  ENSRNOG00000010278 UniProt:  P20607 A6KJN3 LinkDB All DBs Position 4:complement(5214602..5219178) Genome browser AA seq 211 aa AA seqDB search MKFLSARDFQPVAFLGLMLLTATAFPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLR EILEMRKELCNGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGYNQEICLLKICSGLLEF RFYLEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEKLES QKEWLRTKTIQLILKALEEFLKVTMRSTRQT NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atgaagtttctctccgcaagagacttccagccagttgccttcttgggactgatgttgttg acagccactgccttccctacttcacaagtccggagaggagacttcacagaggataccacc cacaacagaccagtatataccacttcacaagtcggaggcttaattacatatgttctcagg gagatcttggaaatgagaaaagagttgtgcaatggcaattctgattgtatgaacagcgat gatgcactgtcagaaaacaatctgaaacttccagaaatacaaagaaatgatggatgcttc caaactggatataaccaggaaatttgcctattgaaaatctgctctggtcttctggagttc cgtttctacctggagtttgtgaagaacaacttacaagataacaagaaagacaaagccaga gtcattcagagcaatactgaaaccctagttcatatcttcaaacaagagataaaagactca tataaaatagtccttcctaccccaacttccaatgctctcctaatggagaagttagagtca cagaaggagtggctaaggaccaagaccatccaactcatcttgaaagcacttgaagaattt ctaaaggtcactatgaggtctactcggcaaacctag

DBGET integrated database retrieval system