KEGG   Rattus norvegicus (rat): 24835
Entry
24835             CDS       T01003                                 

Gene name
Tnf
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01523  Antifolate resistance
rno04010  MAPK signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04064  NF-kappa B signaling pathway
rno04071  Sphingolipid signaling pathway
rno04150  mTOR signaling pathway
rno04210  Apoptosis
rno04217  Necroptosis
rno04350  TGF-beta signaling pathway
rno04380  Osteoclast differentiation
rno04612  Antigen processing and presentation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04640  Hematopoietic cell lineage
rno04650  Natural killer cell mediated cytotoxicity
rno04657  IL-17 signaling pathway
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04920  Adipocytokine signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04940  Type I diabetes mellitus
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05144  Malaria
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05205  Proteoglycans in cancer
rno05310  Asthma
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05410  Hypertrophic cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24835 (Tnf)
   04350 TGF-beta signaling pathway
    24835 (Tnf)
   04064 NF-kappa B signaling pathway
    24835 (Tnf)
   04668 TNF signaling pathway
    24835 (Tnf)
   04071 Sphingolipid signaling pathway
    24835 (Tnf)
   04150 mTOR signaling pathway
    24835 (Tnf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24835 (Tnf)
   04061 Viral protein interaction with cytokine and cytokine receptor
    24835 (Tnf)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    24835 (Tnf)
   04217 Necroptosis
    24835 (Tnf)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24835 (Tnf)
   04620 Toll-like receptor signaling pathway
    24835 (Tnf)
   04621 NOD-like receptor signaling pathway
    24835 (Tnf)
   04622 RIG-I-like receptor signaling pathway
    24835 (Tnf)
   04625 C-type lectin receptor signaling pathway
    24835 (Tnf)
   04650 Natural killer cell mediated cytotoxicity
    24835 (Tnf)
   04612 Antigen processing and presentation
    24835 (Tnf)
   04660 T cell receptor signaling pathway
    24835 (Tnf)
   04657 IL-17 signaling pathway
    24835 (Tnf)
   04664 Fc epsilon RI signaling pathway
    24835 (Tnf)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    24835 (Tnf)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    24835 (Tnf)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    24835 (Tnf)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24835 (Tnf)
   05170 Human immunodeficiency virus 1 infection
    24835 (Tnf)
   05161 Hepatitis B
    24835 (Tnf)
   05160 Hepatitis C
    24835 (Tnf)
   05171 Coronavirus disease - COVID-19
    24835 (Tnf)
   05164 Influenza A
    24835 (Tnf)
   05168 Herpes simplex virus 1 infection
    24835 (Tnf)
   05163 Human cytomegalovirus infection
    24835 (Tnf)
   05169 Epstein-Barr virus infection
    24835 (Tnf)
   05165 Human papillomavirus infection
    24835 (Tnf)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    24835 (Tnf)
   05135 Yersinia infection
    24835 (Tnf)
   05133 Pertussis
    24835 (Tnf)
   05134 Legionellosis
    24835 (Tnf)
   05152 Tuberculosis
    24835 (Tnf)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    24835 (Tnf)
   05144 Malaria
    24835 (Tnf)
   05145 Toxoplasmosis
    24835 (Tnf)
   05140 Leishmaniasis
    24835 (Tnf)
   05142 Chagas disease
    24835 (Tnf)
   05143 African trypanosomiasis
    24835 (Tnf)
  09163 Immune disease
   05310 Asthma
    24835 (Tnf)
   05322 Systemic lupus erythematosus
    24835 (Tnf)
   05323 Rheumatoid arthritis
    24835 (Tnf)
   05321 Inflammatory bowel disease
    24835 (Tnf)
   05330 Allograft rejection
    24835 (Tnf)
   05332 Graft-versus-host disease
    24835 (Tnf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24835 (Tnf)
   05014 Amyotrophic lateral sclerosis
    24835 (Tnf)
   05020 Prion disease
    24835 (Tnf)
   05022 Pathways of neurodegeneration - multiple diseases
    24835 (Tnf)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24835 (Tnf)
   05418 Fluid shear stress and atherosclerosis
    24835 (Tnf)
   05410 Hypertrophic cardiomyopathy
    24835 (Tnf)
   05414 Dilated cardiomyopathy
    24835 (Tnf)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    24835 (Tnf)
   04940 Type I diabetes mellitus
    24835 (Tnf)
   04932 Non-alcoholic fatty liver disease
    24835 (Tnf)
   04931 Insulin resistance
    24835 (Tnf)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24835 (Tnf)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    24835 (Tnf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24835 (Tnf)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24835 (Tnf)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Tumor necrosis fators
   24835 (Tnf)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Cytokines
   24835 (Tnf)
SSDB
Motif
Pfam: TNF DUF956
Other DBs
NCBI-GeneID: 24835
NCBI-ProteinID: NP_036807
RGD: 3876
Ensembl: ENSRNOG00000055156
UniProt: P16599
LinkDB
Position
20
AA seq 235 aa
MSTESMIRDVELAEEALPKKMGGLQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPNK
EEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGM
DLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCP
KDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
NT seq 708 nt   +upstreamnt  +downstreamnt
atgagcacggaaagcatgatccgagatgtggaactggcagaggaggcgctccccaaaaag
atggggggcctccagaactccaggcggtgtctgtgcctcagcctcttctcattcctgctc
gtggcgggggccaccacgctcttctgtctactgaacttcggggtgatcggtcccaacaag
gaggagaagttcccaaatgggctccctctcatcagttccatggcccagaccctcacactc
agatcatcttctcaaaactcgagtgacaagcccgtagcccacgtcgtagcaaaccaccaa
gcggaggagcagctggagtggctgagccagcgtgccaacgccctcctggccaatggcatg
gatctcaaagacaaccaactggtggtaccagcagatgggctgtaccttatctactcccag
gttctcttcaagggacaaggctgccccgactacgtgctcctcacccacaccgtcagccga
tttgccatttcataccaggagaaagtcagcctcctctctgccatcaagagcccttgccct
aaggacacccctgagggagctgagctcaagccctggtatgagcccatgtacctgggagga
gtcttccagctggagaagggggacctgctcagcgctgaggtcaacctgcccaagtactta
gacatcacggagtccgggcaggtctactttggagtcattgctctgtga

DBGET integrated database retrieval system