Rattus norvegicus (rat): 24842 Help Entry 24842             CDS       T01003                                  Symbol Tp53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism rno  Rattus norvegicus (rat) Pathway rno01522   Endocrine resistance rno01524   Platinum drug resistance rno04010   MAPK signaling pathway rno04071   Sphingolipid signaling pathway rno04110   Cell cycle rno04115   p53 signaling pathway rno04137   Mitophagy - animal rno04151   PI3K-Akt signaling pathway rno04210   Apoptosis rno04211   Longevity regulating pathway rno04216   Ferroptosis rno04218   Cellular senescence rno04310   Wnt signaling pathway rno04722   Neurotrophin signaling pathway rno04919   Thyroid hormone signaling pathway rno05012   Parkinson disease rno05014   Amyotrophic lateral sclerosis rno05016   Huntington disease rno05160   Hepatitis C rno05161   Hepatitis B rno05162   Measles rno05163   Human cytomegalovirus infection rno05165   Human papillomavirus infection rno05166   Human T-cell leukemia virus 1 infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05168   Herpes simplex virus 1 infection rno05169   Epstein-Barr virus infection rno05200   Pathways in cancer rno05202   Transcriptional misregulation in cancer rno05203   Viral carcinogenesis rno05205   Proteoglycans in cancer rno05206   MicroRNAs in cancer rno05210   Colorectal cancer rno05212   Pancreatic cancer rno05213   Endometrial cancer rno05214   Glioma rno05215   Prostate cancer rno05216   Thyroid cancer rno05217   Basal cell carcinoma rno05218   Melanoma rno05219   Bladder cancer rno05220   Chronic myeloid leukemia rno05222   Small cell lung cancer rno05223   Non-small cell lung cancer rno05224   Breast cancer rno05225   Hepatocellular carcinoma rno05226   Gastric cancer rno05230   Central carbon metabolism in cancer rno05417   Lipid and atherosclerosis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     24842 (Tp53)    04310 Wnt signaling pathway     24842 (Tp53)    04071 Sphingolipid signaling pathway     24842 (Tp53)    04151 PI3K-Akt signaling pathway     24842 (Tp53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     24842 (Tp53)   09143 Cell growth and death    04110 Cell cycle     24842 (Tp53)    04210 Apoptosis     24842 (Tp53)    04216 Ferroptosis     24842 (Tp53)    04115 p53 signaling pathway     24842 (Tp53)    04218 Cellular senescence     24842 (Tp53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     24842 (Tp53)   09156 Nervous system    04722 Neurotrophin signaling pathway     24842 (Tp53)   09149 Aging    04211 Longevity regulating pathway     24842 (Tp53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     24842 (Tp53)    05202 Transcriptional misregulation in cancer     24842 (Tp53)    05206 MicroRNAs in cancer     24842 (Tp53)    05205 Proteoglycans in cancer     24842 (Tp53)    05203 Viral carcinogenesis     24842 (Tp53)    05230 Central carbon metabolism in cancer     24842 (Tp53)   09162 Cancer: specific types    05210 Colorectal cancer     24842 (Tp53)    05212 Pancreatic cancer     24842 (Tp53)    05225 Hepatocellular carcinoma     24842 (Tp53)    05226 Gastric cancer     24842 (Tp53)    05214 Glioma     24842 (Tp53)    05216 Thyroid cancer     24842 (Tp53)    05220 Chronic myeloid leukemia     24842 (Tp53)    05217 Basal cell carcinoma     24842 (Tp53)    05218 Melanoma     24842 (Tp53)    05219 Bladder cancer     24842 (Tp53)    05215 Prostate cancer     24842 (Tp53)    05213 Endometrial cancer     24842 (Tp53)    05224 Breast cancer     24842 (Tp53)    05222 Small cell lung cancer     24842 (Tp53)    05223 Non-small cell lung cancer     24842 (Tp53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     24842 (Tp53)    05161 Hepatitis B     24842 (Tp53)    05160 Hepatitis C     24842 (Tp53)    05162 Measles     24842 (Tp53)    05168 Herpes simplex virus 1 infection     24842 (Tp53)    05163 Human cytomegalovirus infection     24842 (Tp53)    05167 Kaposi sarcoma-associated herpesvirus infection     24842 (Tp53)    05169 Epstein-Barr virus infection     24842 (Tp53)    05165 Human papillomavirus infection     24842 (Tp53)   09164 Neurodegenerative disease    05012 Parkinson disease     24842 (Tp53)    05014 Amyotrophic lateral sclerosis     24842 (Tp53)    05016 Huntington disease     24842 (Tp53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     24842 (Tp53)    05418 Fluid shear stress and atherosclerosis     24842 (Tp53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     24842 (Tp53)    01522 Endocrine resistance     24842 (Tp53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:rno03000]     24842 (Tp53)    03036 Chromosome and associated proteins [BR:rno03036]     24842 (Tp53)    03400 DNA repair and recombination proteins [BR:rno03400]     24842 (Tp53) Transcription factors [BR:rno03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     24842 (Tp53) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      24842 (Tp53) DNA repair and recombination proteins [BR:rno03400]  Eukaryotic type   Check point factors    Other check point factors     24842 (Tp53) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  24842 NCBI-ProteinID:  NP_112251 RGD:  3889 Ensembl:  ENSRNOG00000010756 UniProt:  P10361 LinkDB All DBs Position 10:54300070..54311525 Genome browser AA seq 391 aa AA seqDB search MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPE EALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSV MCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERC SDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSC MGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPG SAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDS RAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt atggaggattcacagtcggatatgagcatcgagctccctctgagtcaggagacattttca tgcttatggaaacttcttcctccagatgatattctgcccaccacagcgacagggtcacct aattccatggaagatctgttcctgccccaggatgttgcagagttgttagaaggcccagag gaagccctccaagtgtcagctcctgcagcacaggaacctggaactgaggcccctgcaccc gtggcccctgcttcagctacaccgtggcctctgtcatcttccgtcccttctcaaaaaact taccaaggcaactatggcttccacctgggcttcctgcagtcagggacagccaagtctgtt atgtgcacgtactcaatttccctcaataagctgttctgccagctggcgaagacatgccct gtgcagttgtgggtcacctccacacctccacctggtacccgtgtccgtgccatggccatc tacaagaagtcacaacacatgactgaggtcgtgagacgctgcccccaccatgagcgttgc tctgatggtgacggcctggctcctccccaacatcttatccgggtggaaggaaatccgtat gctgagtatctggacgacaggcagacttttcggcacagcgtggtggtaccgtatgagcca cctgaggtcggctccgactataccactatccactacaagtacatgtgcaacagctcctgc atggggggcatgaaccgccggcccatccttaccatcatcacgctggaagactccagtggg aatcttctgggacgggacagctttgaggttcgtgtttgtgcctgtcctgggagagaccgt cggacagaggaagaaaatttccgcaaaaaagaagagcattgcccggagctgcccccaggg agtgcaaagagagcactgcccaccagcacaagctcctctccccagcaaaagaaaaaacca ctcgatggagaatatttcacccttaagatccgtgggcgtgagcgcttcgagatgttccga gagctgaatgaggccttggaattaaaggatgcccgtgctgccgaggagtcaggagacagc agggctcactccagctacccgaagaccaagaagggccagtctacgtcccgccataaaaaa ccaatgatcaagaaagtggggcctgactcagactga

DBGET integrated database retrieval system