Rattus norvegicus (rat): 24986 Help Entry 24986             CDS       T01003                                  Symbol RT1-Ha Name (RefSeq) RT1 class II, locus Ha precursor   KO K06752   MHC class II antigen Organism rno  Rattus norvegicus (rat) Pathway rno04145   Phagosome rno04514   Cell adhesion molecules rno04612   Antigen processing and presentation rno04640   Hematopoietic cell lineage rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04672   Intestinal immune network for IgA production rno04940   Type I diabetes mellitus rno05140   Leishmaniasis rno05145   Toxoplasmosis rno05150   Staphylococcus aureus infection rno05152   Tuberculosis rno05164   Influenza A rno05166   Human T-cell leukemia virus 1 infection rno05168   Herpes simplex virus 1 infection rno05169   Epstein-Barr virus infection rno05310   Asthma rno05320   Autoimmune thyroid disease rno05321   Inflammatory bowel disease rno05322   Systemic lupus erythematosus rno05323   Rheumatoid arthritis rno05330   Allograft rejection rno05332   Graft-versus-host disease rno05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     24986 (RT1-Ha)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     24986 (RT1-Ha)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     24986 (RT1-Ha)    04612 Antigen processing and presentation     24986 (RT1-Ha)    04658 Th1 and Th2 cell differentiation     24986 (RT1-Ha)    04659 Th17 cell differentiation     24986 (RT1-Ha)    04672 Intestinal immune network for IgA production     24986 (RT1-Ha)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     24986 (RT1-Ha)    05164 Influenza A     24986 (RT1-Ha)    05168 Herpes simplex virus 1 infection     24986 (RT1-Ha)    05169 Epstein-Barr virus infection     24986 (RT1-Ha)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     24986 (RT1-Ha)    05152 Tuberculosis     24986 (RT1-Ha)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     24986 (RT1-Ha)    05140 Leishmaniasis     24986 (RT1-Ha)   09163 Immune disease    05310 Asthma     24986 (RT1-Ha)    05322 Systemic lupus erythematosus     24986 (RT1-Ha)    05323 Rheumatoid arthritis     24986 (RT1-Ha)    05320 Autoimmune thyroid disease     24986 (RT1-Ha)    05321 Inflammatory bowel disease     24986 (RT1-Ha)    05330 Allograft rejection     24986 (RT1-Ha)    05332 Graft-versus-host disease     24986 (RT1-Ha)   09166 Cardiovascular disease    05416 Viral myocarditis     24986 (RT1-Ha)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     24986 (RT1-Ha)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     24986 (RT1-Ha) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    24986 (RT1-Ha)   Exosomal proteins of epithelial cells    24986 (RT1-Ha)   Exosomal proteins of breast milk    24986 (RT1-Ha) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Ig_2 C2-set_2 Motif Other DBs NCBI-GeneID:  24986 NCBI-ProteinID:  NP_001008848 RGD:  1595921 Ensembl:  ENSRNOG00000045908 Vega:  OTTRNOG00000001664 UniProt:  Q6MGB1 LinkDB All DBs Position 20:complement(4762425..4772439) Genome browser AA seq 254 aa AA seqDB search MFQTKAEALRASFLAFLLSLPGSGAIKAEHVATYDIFVQTQHPSGECMYAFDGDEQFYVD LDREETVWDLPEFSKVYAFDAQEALPYIDSLKNNLRALIQRYNVTQDPSEPPEVTVFPKN PVELGQPNVLICHIDRLFPPVLNVTWLRNGQPVTEGTSETVFLASTELRFHKFHYLTFIP TAQDVYDCRVEHWSLDQPSLSHWEMQEPVQVSETMETTVCALGLVVGLVGSVVGSALIVR APHGGHNPRTQEPL NT seq 765 nt NT seq  +upstreamnt  +downstreamnt atgttccagactaaagctgaggccctgagagcctccttcctggccttcctgctgagtctc ccaggatctggggccatcaaagcggagcacgtagcaacgtacgacatatttgtgcagacg cagcacccgtctggtgaatgcatgtacgcgtttgacggtgatgagcagttctacgtggat cttgacagggaggagacggtctgggacctgccggagttcagcaaggtgtatgcgtttgac gcccaggaggctcttccctacatcgacagcctgaagaacaacttgagagccttgatccag agatacaacgtcacccaggaccccagcgagcctcccgaggtgaccgtgttccctaagaac ccggtagagctgggccagcccaatgtcctcatctgccacatcgacaggctctttccccca gtgctcaatgtcacatggctacgtaacgggcagccggtcaccgaaggaacttcagagacc gtctttctggccagcacagaactcagatttcacaagttccactacctgaccttcattccc acagcgcaggatgtgtatgactgcagggtggagcactggagcctggaccagccgagtctc agtcactgggaaatgcaggagccagtccaggtgtccgagacaatggagaccacggtctgc gccctgggcctggtggtgggcctggtgggctccgtggttggtagtgcgctcatcgtaagg gctccgcatggcggccataaccctcggacccaggaacccctgtga

DBGET integrated database retrieval system