KEGG   Rattus norvegicus (rat): 25139
Entry
25139             CDS       T01003                                 

Gene name
Slc2a4
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 4
  KO
K07191  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    25139 (Slc2a4)
   04152 AMPK signaling pathway
    25139 (Slc2a4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25139 (Slc2a4)
   04920 Adipocytokine signaling pathway
    25139 (Slc2a4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25139 (Slc2a4)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25139 (Slc2a4)
   04931 Insulin resistance
    25139 (Slc2a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25139 (Slc2a4)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   25139 (Slc2a4)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    25139 (Slc2a4)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Phage_holin_2_3
Other DBs
NCBI-GeneID: 25139
NCBI-ProteinID: NP_036883
RGD: 2711
Ensembl: ENSRNOG00000017226
UniProt: P19357
LinkDB
Position
10
AA seq 509 aa
MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNATW
LGRQGPGGPDSIPQGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLANNVLAV
LGGALMGLANAAASYEILILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VIGILVAQVLGLESMLGTATLWPLLLAITVLPALLQLLLLPFCPESPRYLYIIRNLEGPA
RKSLKRLTGWADVSDALAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL
SGINAVFYYSTSIFELAGVEQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPSMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTCNFIVGMGFQYVADAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS
ATFRRTPSLLEQEVKPSTELEYLGPDEND
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgccgtcgggtttccagcagatcggctctgaagatggggaaccccctcagcagcgagtg
actgggacactggtccttgctgtattctcagctgtgcttggctcccttcagtttggctat
aacattggagtcatcaacgccccacagaaagtgattgaacagagctacaatgcaacttgg
ctgggtaggcagggtcctgggggaccggactccatcccacaaggcaccctcactaccctt
tgggctctctccgtggccatcttctctgtgggtggcatgatttcctcctttctcattggc
atcatttctcaatggttgggaaggaaaagggctatgctggccaacaatgtcttggctgtg
ctggggggcgccctcatgggcctagccaatgccgcggcctcctatgagatactcattctc
ggacggttcctcattggcgcctactcagggctaacatcagggttggtgcctatgtatgtg
ggagaaatcgcccccactcatcttcggggtgccttgggaacactcaaccaattggccatc
gtcattggcattctggttgcccaggtgttgggtttggagtctatgctgggcacagctacc
ctgtggccattgcttctggctatcacagtactccctgctctcctgcagctgcttctgttg
cccttctgtcctgagagcccccgatacctctacatcatccggaacctggaggggcctgcc
cgaaagagtctaaagcgcctgacaggctgggctgatgtgtctgatgcactggctgagctg
aaggatgagaaacggaagttggaaagagagcgtccactgtccttgctgcagctcctgggc
agccgcacccaccggcagcctctgattattgcagtggtgctgcagctgagccagcagctc
tcaggcatcaatgctgttttctactattcaaccagcatctttgagttagctggggtggaa
cagccagcctacgccaccataggagctggtgtggtcaataccgtcttcacgttggtctcg
gtgctcttagtagagcgagctgggcgacggacactccatctcctgggcctggcaggcatg
tgtggctgtgccatcttgatgacggtggctctgctgctgctggagcgggttccatccatg
agttatgtgtccatcgtggccatatttggctttgtggccttctttgagattggtcctggc
cccatcccctggttcattgtggccgagctcttcagccagggcccccgcccagcagccatg
gctgtagctggtttctccaactggacctgtaacttcatcgttggcatgggtttccagtat
gttgcggatgctatgggtccctacgtcttccttctatttgccgtcctcctgcttggcttc
ttcatcttcaccttcctaagagtgcctgaaaccagaggccggacatttgaccagatctcg
gccaccttccgacggacaccttctctcttagagcaggaggtgaaacccagtacagaactt
gaatacttagggccagatgagaatgactga

DBGET integrated database retrieval system