KEGG   Rattus norvegicus (rat): 25351
Entry
25351             CDS       T01003                                 

Gene name
Slc2a2
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 2
  KO
K07593  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04911  Insulin secretion
rno04917  Prolactin signaling pathway
rno04922  Glucagon signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04950  Maturity onset diabetes of the young
rno04973  Carbohydrate digestion and absorption
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    25351 (Slc2a2)
   04922 Glucagon signaling pathway
    25351 (Slc2a2)
   04917 Prolactin signaling pathway
    25351 (Slc2a2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    25351 (Slc2a2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    25351 (Slc2a2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25351 (Slc2a2)
   04950 Maturity onset diabetes of the young
    25351 (Slc2a2)
   04931 Insulin resistance
    25351 (Slc2a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25351 (Slc2a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   25351 (Slc2a2)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    25351 (Slc2a2)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Folate_carrier OATP Phage_holin_2_3 SDH_alpha
Other DBs
NCBI-GeneID: 25351
NCBI-ProteinID: NP_037011
RGD: 3705
Ensembl: ENSRNOG00000011875
UniProt: Q68FZ1
LinkDB
Position
2
AA seq 522 aa
MSEDKITGTLAFTVFTAVLGSFQFGYDIGVINAPQEVIISHYRHVLGVPLDDRRATINYD
INGTDTPLIVTPAHTTPDAWEEETEGSAHIVTMLWSLSVSSFAVGGMVASFFGGWLGDKL
GRIKAMLAANSLSLTGALLMGCSKFGPAHALIIAGRSVSGLYCGLISGLVPMYIGEIAPT
TLRGALGTLHQLALVTGILISQIAGLSFILGNQDYWHILLGLSAVPALLQCLLLLFCPES
PRYLYLKLEEEVRAKKSLKRLRGTEDVTKDINEMRKEKEEASTEQKVSVIQLFTDPNYRQ
PIVVALMLHLAQQFSGINGIFYYSTSIFQTAGISQPVYATIGVGAINMIFTAVSVLLVEK
AGRRTLFLAGMIGMFFCAVFMSLGLVLLDKFTWMSYVSMTAIFLFVSFFEIGPGPIPWFM
VAEFFSQGPRPTALALAAFSNWVCNFIIALCFQYIADFLGPYVFFLFAGVVLIFTLFTFF
KVPETKGKSFDEIAAEFRKKSGSAPPRKAAVQMEFLGSSETV
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgtcagaagacaagatcaccggaaccttggctttcactgtcttcactgcagtgctgggt
tccttccagttcggatatgacatcggtgtgatcaatgcacctcaagaggtaataatatcc
cattatcgacatgttttgggtgttcctctggatgaccgaagagctaccattaactatgac
atcaatggcacagacaccccactcatagtcacaccagcacatacgacaccagacgcctgg
gaagaagagactgaaggatctgctcacatagtcactatgctctggtctctgtctgtgtcc
agctttgcagtaggcggaatggtcgcctcgttctttggtgggtggcttggggacaaactc
ggaaggatcaaagccatgttggctgcaaacagcctctcgttgactggagccctcttgatg
gggtgttccaaatttggaccggcacatgctctcatcattgctggaagaagcgtatcagga
ctgtactgtgggctaatttcaggactggttccaatgtacattggcgagattgctccaacc
acactcaggggtgccctgggcactcttcaccaactggctcttgtcacaggcattcttatt
agtcagattgctggcctcagcttcattctgggcaatcaggattactggcacatcctactt
ggcctatctgctgtaccagctctcctgcagtgtctgctactgctcttctgtccagaaagc
cccagatacctttacctaaagttggaagaggaagtcagggcaaagaaaagcttgaaaaga
ctaaggggcactgaggacgtcaccaaagatattaatgagatgaggaaagaaaaggaagag
gcgtcgactgagcagaaggtctccgtgatccagctcttcacggatccgaattatcggcag
cccattgtggtggcactgatgctacacttggctcagcagttctctggaatcaatgggata
ttttactattcaaccagcatttttcagacagctggcatcagccagcctgtgtatgcaacc
atcggcgttggtgccatcaacatgatcttcacggctgtctctgtgctgcttgtggagaaa
gcggggcggcggaccctgttcctggccgggatgattggcatgtttttctgtgccgtcttc
atgtcgctgggactggtgttgctggataagttcacctggatgagttatgtgagcatgacg
gccatcttcctcttcgtcagtttctttgagattgggccaggtccaatcccttggttcatg
gttgctgaatttttcagccaaggaccccgtcccacggctctggcactggctgccttcagc
aactgggtctgcaatttcatcatcgccctctgcttccagtacattgcggacttcctcggg
ccttacgtgttcttcctttttgctggggtggtcctgatcttcaccctgttcacatttttt
aaagttccagaaaccaaaggaaagtcttttgacgaaattgctgcagaattccggaagaag
agtggttcggccccaccacgcaaagccgctgtacaaatggaattcctggggtcttcagag
actgtgtga

DBGET integrated database retrieval system