Rattus norvegicus (rat): 287287 Help Entry 287287            CDS       T01003                                  Symbol Il4 Name (RefSeq) interleukin-4 precursor   KO K05430   interleukin 4 Organism rno  Rattus norvegicus (rat) Pathway rno04060   Cytokine-cytokine receptor interaction rno04151   PI3K-Akt signaling pathway rno04630   JAK-STAT signaling pathway rno04640   Hematopoietic cell lineage rno04657   IL-17 signaling pathway rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04660   T cell receptor signaling pathway rno04664   Fc epsilon RI signaling pathway rno04672   Intestinal immune network for IgA production rno05140   Leishmaniasis rno05200   Pathways in cancer rno05310   Asthma rno05320   Autoimmune thyroid disease rno05321   Inflammatory bowel disease rno05330   Allograft rejection Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     287287 (Il4)    04151 PI3K-Akt signaling pathway     287287 (Il4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     287287 (Il4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     287287 (Il4)    04660 T cell receptor signaling pathway     287287 (Il4)    04658 Th1 and Th2 cell differentiation     287287 (Il4)    04659 Th17 cell differentiation     287287 (Il4)    04657 IL-17 signaling pathway     287287 (Il4)    04664 Fc epsilon RI signaling pathway     287287 (Il4)    04672 Intestinal immune network for IgA production     287287 (Il4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     287287 (Il4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     287287 (Il4)   09163 Immune disease    05310 Asthma     287287 (Il4)    05320 Autoimmune thyroid disease     287287 (Il4)    05321 Inflammatory bowel disease     287287 (Il4)    05330 Allograft rejection     287287 (Il4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:rno04052]     287287 (Il4)    00536 Glycosaminoglycan binding proteins [BR:rno00536]     287287 (Il4) Cytokines and neuropeptides [BR:rno04052]  Cytokines   Interleukins    287287 (Il4) Glycosaminoglycan binding proteins [BR:rno00536]  Heparan sulfate / Heparin   Cytokines    287287 (Il4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 MatB Rv3651-like_middle Motif Other DBs NCBI-GeneID:  287287 NCBI-ProteinID:  NP_958427 RGD:  2898 Ensembl:  ENSRNOG00000007624 UniProt:  P20096 A6HED6 LinkDB All DBs Position 10:complement(38272003..38277549) Genome browser AA seq 147 aa AA seqDB search MGLSPHLAVTLFCFLICTGNGIHGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATR NTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLCRGVSGLNSLRSCTVNEST LTTLKDFLESLKSILRGKYLQSCTSMS NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgggtctcagcccccaccttgctgtcaccctgttctgctttctcatatgtaccgggaac ggtatccacggatgtaacgacagccctctgagagagatcatcaacactttgaaccaggtc acagaaaaagggactccatgcaccgagatgtttgtaccagacgtccttacggcaacaagg aacaccacggagaacgagctcatctgcagggcttccagggtgcttcgcaaattttacttc ccacgtgatgtacctccgtgcttgaagaacaagtctggggttctcggtgaactgaggaaa ctctgtagaggtgtcagcggtctgaactcactgagaagctgcaccgtgaatgagtccacg ctcacaacactgaaagacttcctggaaagcctaaaaagcatcctacgagggaaatacttg cagtcctgcacttccatgtcctaa

DBGET integrated database retrieval system